Conserved Protein Domain Family
PLN02279

?
PLN02279: PLN02279 
ent-kaur-16-ene synthase
Statistics
?
PSSM-Id: 177918
View PSSM: PLN02279
Aligned: 5 rows
Threshold Bit Score: 1420.81
Threshold Setting Gi: 15219383
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
297839811   1 MSINLRSSGCSSPISATLEKRLEAVDQTRANNVSFEQTKDKIRKMLDKVELSVSAYDTSWVAMVPSPTSQNAPLFPQCVK 80 
15219383    1 MSINLRSSGCSSPISATLERRLDSEVQTRANNVSFEQTKEKIRKMLEKVELSVSAYDTSWVAMVPSPSSQNAPLFPQCVK 80 
224098838   1 -------------------------------MQNFHGTKERIKKMFDKIELSVSSYDTAWVAMVPSPDCPETPCFPECTK 49 
225462287  20 LHHKPKSSCVTAPISASLSPGLKTWTEGNHVGLGFEGTKERIKKMFDKVELSVSSYDTAWVAMVPSPYSSQAPYFPECVN 99 
255586055   1 --------------------------------------------MFDKIELSVSPYDTAWVAMIPSLNSVQAPFFPECTK 36 
297839811  81 WLLEYQHEDGSWGLDnHDHQSLKKDVLSSTLASILALKKWGTGERQINKGLQFIELNSASVTDETIQKPAGFDIIFPGMI 160
15219383   81 WLLDNQHEDGSWGLDnHDHQSLKKDVLSSTLASILALKKWGIGERQINKGLQFIELNSALVTDETIQKPTGFDIIFPGMI 160
224098838  50 WILENQLGDGSWSLP-HGNPLLVKDALSSTLACILALKRWGIGEEQINKGLRFIELNSASVTDNEQHKPIGFDIIFPGMI 128
225462287 100 WLLENQSHDGSWGLP-HPHPMLVKDALSSTLASVLALKRWGVGEEQRNKGLWFIASNFASVSDEKQHSPIGFDIIFPGMI 178
255586055  37 WIVDNQLSDGSWGLP-HHHPLLIKDTLSSTLACVLALKKWGVGETLVNKGLQFIELNSTSLNDEKQHTPIGFDIIFPAML 115
297839811 161 EYARDLNLAIPLGSEVVDAMIRKRDLDLKCD-SERFSKGREAYLAYVLEGTRNLKDWDLIVKYQRKNGSLFDSPAITAAA 239
15219383  161 KYARDLNLTIPLGSEVVDDMIRKRDLDLKCD-SEKFSKGREAYLAYVLEGTRNLKDWDLIVKYQRKNGSLFDSPATTAAA 239
224098838 129 EYAIDLDLNLPLKPTDINSMLHRRALELTSG-GGKNLEGRRAYLAYVSEGIGKLQDWEMAMKYQRKNGSLFNSPSTTAAA 207
225462287 179 EYAKELDLNLPLGQRDVDAMLQKRDLELKG--LGSNTKSREAYLAYISEGMGRLQDWEMVMKYQMKNGSLLNSPSATAAA 256
255586055 116 EHAKELALNLPLKSDVIDAMLHRRDVDLKSGsGGSNTEGRKAYLAYIAEGIGKFQDWEMVMKYQRKNGSLFNSPSTTAAA 195
297839811 240 FTQFGNDGCLRYLCSLLQKFEAAVPTVYPFDQYARLSLIVTLESLGIDRDFKTEIKSILDETYRYWLRGDEEICLELATC 319
15219383  240 FTQFGNDGCLRYLCSLLQKFEAAVPSVYPFDQYARLSIIVTLESLGIDRDFKTEIKSILDETYRYWLRGDEEICLDLATC 319
224098838 208 FIHIQDAECLHYIRSLLQKFGNAVPTIYPLDIYARLSMVDALERLGIDRHFRKERKFVLDETYRFWLQGEEEIFSDNATC 287
225462287 257 LSHLQNAGCLNYLRSLLEKFGNAVPTVYPLDLYARLCLVDNLERLGIDRYFRMEIRSVLDETYRCWLQREEEIFADRATC 336
255586055 196 FSHLRNADCLQYLQSVLQKYGNAVPTIYPLDVYSRLLMVDILERLGIDRHFRKEIKLVLEETYRYWLQGNEEIFLDCITC 275
297839811 320 ALAFRLLLAHGYDVSYDPLKPFAEESgFSDTLEGYVKNTFSVLELFKAAQ--SYPHESALKKQCSWTKQYLEMELSNWLK 397
15219383  320 ALAFRLLLAHGYDVSYDPLKPFAEESgFSDTLEGYVKNTFSVLELFKAAQ--SYPHESALKKQCCWTKQYLEMELSSWVK 397
224098838 288 ALAFRILRLNGYDVS-------LEDH-FSNSLGGYLKDSGAALELYRALQl-SYPDESLLEKQNSRTSYFLKQGLSNVSL 358
225462287 337 AIAFRILRLNGYDISSVPLAQFAEDD-QYFKFGQDFKDLGAALELFRASEmiIHPDEVVLEKQNSWSSHFLRQGLSNSSI 415
255586055 276 AMAFRILRVNGYDVSSDVFTQFTEDH-FFDSLGGYLKDTRTVLELYRASQi-LYPDEPLLEKQNSWTNHFLEKCLSSGSS 353
297839811 398 TSVR-DKYLKKEVEDALAFPSYASLERSDHRRKLLNgcvfSAVENTRVTKTSYRLHNICSSGILKLAVDDFNFCQSIHRE 476
15219383  398 TSVR-DKYLKKEVEDALAFPSYASLERSDHRRKILNg---SAVENTRVTKTSYRLHNICTSDILKLAVDDFNFCQSIHRE 473
224098838 359 CGDRlRKNIIGEVHDALNFSDHANLQRLAIRRRIKH----YATDDTRILKTSYRCSTIGNQDFLKLAVEDFNICQSIQRE 434
225462287 416 HADRlNKYIAQEVEDALRFPYYANLDRIANRRSIEH----YNVDDTRILKTAYRSSHVCNKDFLKLAVEDFNFCQSIHQN 491
255586055 354 YADGpRECITEVVHNALNCPYYADLERLTNRRSIEN----YNVDETRILKASYRCLNTGNQHFLKLAVEDFNLCQLIHQE 429
297839811 477 EMERLDRWIVENRLQELKFARQKLAYCYFSGAATLFSPELSDARISWAKGGVLTTVVDDFFDVGGSKEELENLIHLVEKW 556
15219383  474 EMERLDRWIVENRLQELKFARQKLAYCYFSGAATLFSPELSDARISWAKGGVLTTVVDDFFDVGGSKEELENLIHLVEKW 553
224098838 435 EFKHIERWVVERRLDKLKFARQKEAYCYFSAAATLFAPELSDARMSWAKNGVLTTVVDDFFDVGGSEEELVNLIELIERW 514
225462287 492 ELKQLERWIIENRLDKLKFARQKLAYCYFSAAATIFSPEQSDARLSWAKNSVLTTVVDDFFDIGGSEEELLNLIQLVEKW 571
255586055 430 ELQQLGRWVVEKRLNKLKFARQKLGYCYFSAAATLFAPELSDARLSWAKNGVLTTVVDDFFDVGGSVEELINLIQLIEKW 509
297839811 557 DLNGVPEYRSEHVEIIFSVLRDTILETGEKAFIYQGRSVTHQIVKIWLDLLKSMLREAEWSSDKSTPSLEDYMENAYISF 636
15219383  554 DLNGVPEYSSEHVEIIFSVLRDTILETGDKAFTYQGRNVTHHIVKIWLDLLKSMLREAEWSSDKSTPSLEDYMENAYISF 633
224098838 515 DVNGSADFCSEEVEIIYSAIHSTISEIGDKSFGWQGRDVKSQVIKIWLDLLKSMLTEAQWSSNKSVPTLDEYMTTAHVSF 594
225462287 572 DIDVAVDCCSEQVEIVFSALHSTISEIGVKASAWQARNVTSHIIDIWLKLLRSMLQEAQWVSNKSAPTMDEYMTNAYVSF 651
255586055 510 DVDESTHFCSEQVEIIFSALRSTISEIGDKAFTWQGRKVTSHVIKIWLDLLKSMLTETLWTKSKSIPTLDEYMINGYVSF 589
297839811 637 ALGPIVLPATYLIGPPLPEKIVDSHQYKKLYKLVSTMGRLLNDIQGFKRESAEGKLNAVSLHMKHERDNSSKEEIIESMK 716
15219383  634 ALGPIVLPATYLIGPPLPEKTVDSHQYNQLYKLVSTMGRLLNDIQGFKRESAEGKLNAVSLHMKHERDNRSKEVIIESMK 713
224098838 595 ALGPIVLPALYFVGPKLSEEVAGHPELLNLYKVTSTCGRLLNDWRSFKRESEEGKLNAISLYMIHSGGASTEEETIEHFK 674
225462287 652 ALGPIVLPALYFVGPKLSEEVVEGPECHKLYKLMSTCGRLLNDIHSFKRESKEGKANALALHMIHGNGVTTEEQAIREMK 731
255586055 590 ALGPIVLPALFLVGPKLTEEDVRDPELHDLFKAMGTCGRLLNDWRGFQRESKEGKLNAVSLHMIQGNGGVNEEEAIRKIK 669
297839811 717 ALAERKREELHKLILEEKGSAVPRECKEAFLKMSKVLNLFYRKDDGFTSHDLMSLVKSVIYEPVTLQEESLT 788
15219383  714 GLAERKREELHKLVLEEKGSVVPRECKEAFLKMSKVLNLFYRKDDGFTSNDLMSLVKSVIYEPVSLQEESLT 785
224098838 675 GLIDSQRRQLLQLVLQEKDSIIPRPCKDLFWNMIKLLHTFYMKDDGFTSNEMRNVVKAIINEPISLDEL--- 743
225462287 732 GLVKSQRRELQRLVLQEKGSTVPRICKDLFWKMSKVLHTFYEKDDGFTSHDMLRAVKSVIYEPVLLAEF--- 800
255586055 670 GLINSQRSELLRLVLREKNSNIPRACKDLFWKMIKVLHLFYLKDDGFTSNEMISTANAVITEPVAFHGPFLS 741
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap