Conserved Protein Domain Family
PLN02277

?
PLN02277: PLN02277 
H(+) -translocating inorganic pyrophosphatase
Statistics
?
PSSM-Id: 177916
View PSSM: PLN02277
Aligned: 16 rows
Threshold Bit Score: 1179.97
Threshold Setting Gi: 219115041
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
255081072   1 MACFASLAFAAYLAKWVLSKDEGTADMQEVSDAIREGADGFFATQYNLIGKLAGVLAIVIYLIYSARALTKEQVDAGIGQ 80 
115446543  70 CICTLSLFFSLYLTKWVLAKDEGPPEMSEISDAIRDGAEGFFRTQYGTISKMACILALVILGIYLFRSTTPQQEASGVGR 149
168032475  67 TICIGSLVYAIYLASWVLAKDEGPPEMSEISDAIRDGAEGFFRTQYGSISRMAGVLGFVILGIYMFRKSTPEQEAAGLEK 146
168009622  75 IVCTGSLAYAVYLASWVLAKDEGPPEMSEISDAIRDGAEGFFRTQYGSISRMAGVLAFVIFGIYMFRKSTPEQDAAGLEK 154
145345645  95 VACAGSLAFAGHLARWTLAVDEGSEDMRAVSDAIRDGADGFFATQYGLISRLAGVVAGSIFFVYLFRATTPEQQEAGVGA 174
242086144  70 CICTLSLFFSLYLTKWVLAKDEGPPEMSEISDAIRDGAEGFFRTQYGTISKMAFILAFVILGIYLFRSTTPQQEASGLGR 149
225443361  71 SVCIISFLLSVYLTKWVLAKDEGPPEMAQISDAIRDGAEGFFRTQYGTISKMAMLLALVILSIYLFRSTTPQQESSGIGR 150
255544488  70 TICIISFLLSIYLTKWVLAKDEGPPEMVQISDAIRDGAEGFFRTQYGTISKMAVLLALVILCIYLFRSTTPQQEAYGLGR 149
302806202  73 AVCTLSIFFATYLSSWVLAKDEGPPEMVQISDAIRDGAEGFFRTQYGAITNMAVVLAFGILGIYLFRRSTPQQEAAGIDK 152
302808421  73 AVCTLSIFFATYLSSWVLAKDEGPPEMVQISDAIRDGAEGFFRTQYGAITNMAVVLAFGILGIYLFRRSTPQQEAAGIDK 152
255081072  81 QTFAILTTFSFCTGALASAASGYVGMWVSVRANVRVAGAARRSAREALVVATRAGGFAAIVVVAMTVLGVSVLFTFYSFL 160
115446543 150 TTSAYITVASFLLGALCSGIAGFVGMWVSVRANVRVSSAARRSAREALQIAVRAGGFSAIVVVGMAVFGVAILYATFYVW 229
168032475 147 STLAFITSLSFLLGAVCSGIAGYIGMWVSVRANVRVSSAARRSAREALLVAVRAGGFSALIVVGMTVMGVAVLFASFYVF 226
168009622 155 STLAFITVLSFLLGALCSGIAGYIGMWVSVRANVRVSSAARRSAREALLVAVRAGGFSALIVIGMTVMGVAVLFASFYVF 234
145345645 175 FTMATLTTVSFVSGAVCSGVSGYVGMWVSVRANVRVASSARHGAREALTVALRAGGFAALIVVGMTVLGVTILFSVFSFI 254
242086144 150 ATLAYITVASFLLGALCSGLAGFVGMWVSVRANVRVSSAARRSAREALQIAVRAGGFSAIVVVCMAVFGVAILYSTFYVW 229
225443361 151 STTAYITVAAFLLGALCSGIAGYVGMWVSVRANVRVSSAARRSAREALQIAVRAGGFSALVVVGMAVIGVAILYATFYVW 230
255544488 150 STSAYITVAAFLLGALCSGIAGYVGMWVSVRANVRVSSAARRSAREALQIAVRAGGFSAMVVVGMAVIGIAILYAVFYVW 229
302806202 153 ATSAFITVLSFLLGALCSGIAGYVGMWVSVRANVRVSSAARRSAREALLIAVRAGGFSALIVVGMTVLGVAVLYAVFYVY 232
302808421 153 ATSAFITVLSFLLGALCSGIAGYVGMWVSVRANVRVSSAARRSAREALLIAVRAGGFSALIVVGMTVLGVAVLYAVFYVY 232
255081072 161 FGVGRAGGTSINEMPLMLVGYGFGASFVALFAQLGGGIYTKAADVGADLVGKVEAGIPEDDPRNPAVVADLVGDNVGDCS 240
115446543 230 LEVDSPGSMKVTDLPLLLVGYGFGASFVALFAQLGGGIYTKAADVGADLVGKVEQGIPEDDPRNPAVIADLVGDNVGDCA 309
168032475 227 LSVDTIHNMKMTELPLLLVGYGFGASFVALFAQLGGGIYTKAADVGADLVGKVEQGIPEDDARNPAVIADLVGDNVGDCA 306
168009622 235 LGVDTVNNMKMTELPLLLVGYGFGASFVALFAQLGGGIYTKAADVGADLVGKVEQGIPEDDARNPAVIADLVGDNVGDCA 314
145345645 255 FSVGRDGGMDVHEIPLMLVGYGFGASFVALFAQLGGGIYTKAADVGADLVGKVEQGIPEDDPRNPAVIADLVGDNVGDCS 334
242086144 230 LGVDSPGSMKVTDLPLLLVGYGFGASFVALFAQLGGGIYTKAADVGADLVGKVEQGIPEDDPRNPAVIADLVGDNVGDCA 309
225443361 231 LGVDSTGSMKVTDLPLLLVGYGFGASFVALFAQLGGGIYTKAADVGADLVGKVEQGIPEDDPRNPAVIADLVGDNVGDCA 310
255544488 230 LGVDTPGSMKVTDLPLLLVGYGFGASFVALFAQLGGGIYTKAADVGADLVGKVEQGIPEDDPRNPAVIADLVGDNVGDCA 309
302806202 233 LNVDSPTGMKATELPLLLVGYGFGASFVALFAQLGGGIYTKAADVGADLVGKVEQGIPEDDPRNPAVIADLVGDNVGDCA 312
302808421 233 LNVDSPTGMKATELPLLLVGYGFGASFVALFAQLGGGIYTKAADVGADLVGKVEQGIPEDDPRNPAVIADLVGDNVGDCA 312
255081072 241 ARGADLFESIAAEVISAMILGATMAKKANIPDSTGFIMFPLVVHALDCLVSAAGIMSVGERPSLNPNgGRKEDPYEVLKG 320
115446543 310 ARGADLFESIAAEIISAMILGGTMAQRCKIEDPSGFILFPLVVHSFDLVISSVGILSIRGTRDSGLI-SPIEDPMAIMQK 388
168032475 307 ARGADLFESIAAEIISAMILGGTMAKRCKLDDPSGFILFPLVVHSFDLVVSAIGIASIKGTRDPSSK-SLIEDPMIILQK 385
168009622 315 ARGADLFESIAAEIISAMILGGTMAKRCKLEDPSGFILFPLVVHSFDLVVSAIGIASIKGTRDPSSK-SILEDPMIILQK 393
145345645 335 ARGADLFESIAAEVISAMILGATMAKSAGIEDSTGFIMFPLVIHAMDCIVSACGIMSISETST------RREDPYKVLKG 408
242086144 310 ARGADLFESIAAEIISAMILGGTMAQRCKIEDPSGFILFPLVVHSFDLVVSSVGILSIRGTRDSGLI-SSIEDPMAIMQK 388
225443361 311 ARGADLFESIAAEIISAMILGGTMAQRCKIEDPSGFILFPLVIHSFDLVISSVGIFSIRGTRDSGVK-SPVEDPMAILQK 389
255544488 310 ARGADLFESIAAEIISAMILGGTMAQRCKIEDPSGFILFPLVIHSFDLVISSIGILSIRSTRDSSVK-SAMEDPMAILQK 388
302806202 313 ARGADLFESIAAEIISAMILGGTMVKRCKLEDASGFILFPLVVHSFDLVVSAIGILSIKNAREVGTK--YMEDPMAVLQR 390
302808421 313 ARGADLFESIAAEIISAMILGGTMVKRCKLEDASGFILFPLVVHSFDLVVSAIGILSIKNAREVGTK--YMEDPMAVLQR 390
255081072 321 GYAVAMGLSVVGFGIATRVMLYVDDAPSAWFHFFGCGMIGTASAYAFVFIAQYYTDYKYPPVRVIAEASTTGHGTNII-A 399
115446543 389 GYSITILLAVVTFGVSTRWLLYTEQAPSAWLNFALCGLVGIITAYAFVWISKYYTDYKHEPVRLLALSSSTGHGTNII-A 467
168032475 386 GYSVTLFLAVLAFGGSTRWLLYTEQAPSAWFHFALCGLVGIVTAYVFVWISQYYTDYKYDPVRQVALSSTTGHGTNIIaA 465
168009622 394 GYSVTLFLAVLAFGGSTRWLLYTEQAPSAWFHFALCGLVGIITAYAFVWISQYYTDYKYDPVRQVALASTTGHGTNVI-A 472
145345645 409 GYNVAISLAVVGFGVACRVMLVSDKHPGAWFSFYMCGLIGIACAYAFVFIAQYYTDYKFPPVRHIAEASTTGHGTNII-A 487
242086144 389 GYSVTIVLAVLTFGVSTRWLLYTEQAPSAWLNFALCGLVGIITAYAFVWISKYYTDYKYEPVRLLALSSSTGHGTNII-A 467
225443361 390 GYSITIILAVLTFGLSTRWLLYTEQAPSAWMNFALCGLVGIMTAYVFVWITKYYTDYKHEPVRTLALSSSTGHGTNII-A 468
255544488 389 GYSVTIVLAVITFGASTRWMLHTEQAPSAWFNFALCGLVGIITAYVFVWITKYYTDYKHEPVRTLALASTTGHGTNII-A 467
302806202 391 GYSVAVVLAVITFGASTRWLLYTEQAPTAWFHFALCGLVGIITAYLFVWISQYYTDYKYEPVRLVALASSTGHGTNII-A 469
302808421 391 GYSVAVVLAVITFGASTRWLLYTEQAPTAWFHFALCGLVGIITAYLFVWISQYYTDYKYEPVRLVALASSTGHGTNII-A 469
255081072 400 GVGVGMESTAAPVLCISAAIISAYWFGQTSGLTDKStGEPTGGLFGTAVATMGMLSTAAYVLTMDVFGPIADNAGGIVEM 479
115446543 468 GVSLGLESTALPVLVISVAIISAFWLGHTSGLVDES-GNPTGGLFGTAVATMGMLSTAAYVLTMDMFGPIADNAGGIVEM 546
168032475 466 GVSLGLESTAMPVLVISLSIVTAYWLGKTSGLQDNQ-GIPTGGLFGTAVATMGMLSTAGYVLTMDMFGPIADNAGGIVEM 544
168009622 473 GVGLGLESTAMPVLVISVSVVITYWLGKTSGLQDSR-GMPTGGLFGTAVATMGMLSTAGYVLTMDMFGPIADNAGGIVEM 551
145345645 488 GIGVGMESTAVPVIVISIAIISAYWCGNASGITDAN-GKAIGGLFGTAVATMGMLSTAAYVLTMDVFGPIADNAGGIVEM 566
242086144 468 GVSLGLESTALPVLVISVAIISAYWLGQTSGLVDES-GNPTGGLFGTAVATMGMLSTAGYVLTMDMFGPIADNAGGIVEM 546
225443361 469 GVSLGLESTALPVIVISISIVSAFWLGQTSGLVDET-GNPTGGLFGTAVATMGMLSTAAYVLTMDMFGPIADNAGGIVEM 547
255544488 468 GVSLGLESTALPVIVISISIVSAFWLGHTSGLVDEA-GKPTGGLFGTAVATMGMLSTAAYVLTMDMFGPIADNAGGIVEM 546
302806202 470 GVGLGLESTAMPVLVISVAIVSAYWLGRTSGLVDSK-GAPVGGLFGTAIATMGMLSTAAYVLTMDMFGPIADNAGGIVEM 548
302808421 470 GVGLGLESTAMPVLVISVAIVSAYWLGRTSGLVDSK-GAPVGGLFGTAIATMGMLSTAAYVLTMDMFGPIADNAGGIVEM 548
255081072 480 SDQPESVRECTDALDAVGNTTKATTKGYAIGSAALASFLLFSAYMDEVEAFTGKPFKQVDIAVPEVFVAGLLGSMIVYLF 559
115446543 547 SQQPESVREITDILDAVGNTTKATTKGFAIGSAALASFLLFSAYMDEVAAFAQLPFKEVDIAIPEVFVGGLLGSMLIFLF 626
168032475 545 SQQPESVREITDLLDAVGNTTKATTKGFAIGSAALASFLLFSAYMDEVSSFSGVAFTTVDIAIPEVFVGGLLGSMLIYLF 624
168009622 552 SQQPQNVREITDLLDAVGNTTKATTKGFAIGSAALASFLLFSAYMDEVSSFSGVPFTTVDIAIPEVFVGGLLGSMLIYLF 631
145345645 567 SDQPESVRDICDELDAVGNTTKATTKGYAIGSAALASFLLFSAFMDEVTAFTGKPFNQVDIAIPEVFVAGLLGAALVYLF 646
242086144 547 SQQPESVREITDVLDAVGNTTKATTKGFAIGSAALASFLLFSAYMDEVASFAQLPFKEVDIAVPEIFVGGLLGSMLIFLF 626
225443361 548 SQQPESVREITDLLDAVGNTTKATTKGFAIGSAALASFLLFSAYMDEVSAFAHEPFKQVDIAIPEVFVGGLLGSMLIFLF 627
255544488 547 SQQPESVREITDVLDAVGNTTKATTKGFAIGSAALASFLLFSAYMDEVATFAHVPFNQVDIAIPEVFVGGLLGSMLIFLF 626
302806202 549 SQQPESVRDITDVLDAVGNTTKATTKGFAIGSAALASFLLFSAYMDEVSSFTQISFTEVDIAIPEVFVGGLLGAMLIFVF 628
302808421 549 SQQPESVRDITDVLDAVGNTTKATTKGFAIGSAALASFLLFSAYMDEVSSFTQISFTEVDIAIPEVFVGGLLGAMLIFVF 628
255081072 560 TAFACTAVGRSAQEVVTEVRRQFAERPGIMSREEKPDYGRCVSIVAQSALREMIKPGVLAVGGPVAVGVVFRLIGRATGQ 639
115446543 627 SAWACSAVGRTAQEVVNEVRRQFIERPGIMDYNEKPDYGRCVAIVASASLREMIRPGALAIISPMAVGIIFRMLGHATGR 706
168032475 625 SAWACAAVGRTAQEVVSEVRRQFSERPGIMTYQEKPDYARCVSIVAAASLREMIKPGALAVISPIVIGLVFRLVGQATDQ 704
168009622 632 SAWACAAVGRTAQEVVSEVRRQFAERPGIMTYQEKPDYARCVSIVAAASLREMIKPGALAVISPIAIGILFRLVGQATNQ 711
145345645 647 SAWSITAVGRSAQEVVREVRRQFAERPGIMTGEEKPDYARCVAIVAQSALREMVRPGALAVLSPVVVGIVFKNLGAATAQ 726
242086144 627 SAWACSAVGKTAQEVVNEVRRQFIERPGIMDYKEKPDYGRCVAIVASASLREMIKPGALAIISPMAVGVVFRILGHYTAQ 706
225443361 628 SAWACSAVGRTAQEVVNEVRRQFIERPGIMDYKEKPDYGRCVAIVASASLREMIKPGALAIVSPIVVGFLFRILGYYTGH 707
255544488 627 SAWACSAVGRTAQEVVKEVRRQFIERPGIMDYKEKPDYGRCVAIVASASLREMIKPGALAIVSPIVVGILFRILGHYTGH 706
302806202 629 SAWSCAAVGKTAQEVVNEVRRQFAERPGIMTYQDKPDYGRCVSIVAKASLREMIKPGALAVISPIIVGVVFRIVGVYTEQ 708
302808421 629 SAWSCAAVGKTAQEVVNEVRRQFAERPGIMTYQDKPDYGRCVSIVAKASLREMIKPGVLAVISPIIVGVVFRIVGVYTEQ 708
255081072 640 ELLGARAVAGMLMFATVAGILMALFLNTAGGAWDNAKKYVETGAHGGKNSEAHKAAVTGDTVGDPFKDTAGPSIHVLIKM 719
115446543 707 PLLGAKVVAAMLMFATVSGILMALFLNTAGGAWDNAKKYIETGALGGKGSESHKAAVTGDTVGDPFKDTAGPSIHVLIKM 786
168032475 705 PLLGAKAVAGMLMFATVSGILMALFLNTSGGAWDNAKKYIESGAFGGKGSDAHKAAVTGDTVGDPFKDTAGPSLHVLIKM 784
168009622 712 PLLGAKAVAGMLMFATVSGILMALFLNTAGGAWDNAKKYIESGAYGGKGSDAHKAAVTGDTVGDPFKDTAGPSLHVLIKM 791
145345645 727 ELLGVKAVAAFLMFATVAGILMALFLNTAGGAWDNAKKYIETGAHGGKGSEAHKAAVSGDTVGDPFKDTAGPSIHVLIKM 806
242086144 707 PLLGAKVVASMLMFATVAGILMALFLNTAGGAWDNAKKYIETGALGGKGSESHKAAVTGDTVGDPFKDTAGPSLHVLIKM 786
225443361 708 PLLGAKVVASMLMFATVAGILMALFLNTAGGAWDNAKKYIETGALGGKGSDAHKAAVTGDTVGDPFKDTAGPSLHVLIKM 787
255544488 707 PLLGAKVVASMLMFGTVSGILMALFLNTAGGAWDNAKKYIETGALGGKGSDCHKAAVTGDT------------------- 767
302806202 709 PLLGAKAVAGMLMFATVSGILMALFLNTAGGAWDNAKKFIESGALGGKGSEAHKAAVTGDTVGDPFKDTAGPSLHVLIKM 788
302808421 709 PLLGAKAVAGMLMFATVSGILMALFLNTAGGAWDNAKKFIESGALGGKGSEAHKAAVTGDTVGDPFKDTAGPSLHVLIKM 788
255081072 720 LATITLVMAPMFL 732
115446543 787 LATITLVMAPIFL 799
168032475 785 LATITLVMAPLFL 797
168009622 792 LATITLVMAPLFL 804
145345645 807 LATITLVMAPMFL 819
242086144 787 LATITLVMAPIFL 799
225443361 788 LATITLVMAPVFL 800
255544488     -------------    
302806202 789 LSTITLVMAPLFL 801
302808421 789 LSTITLVMAPLFL 801
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap