Conserved Protein Domain Family
PLN02272

?
PLN02272: PLN02272 
glyceraldehyde-3-phosphate dehydrogenase
Statistics
?
PSSM-Id: 177912
View PSSM: PLN02272
Aligned: 13 rows
Threshold Bit Score: 790.98
Threshold Setting Gi: 168059401
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
225462254   1 MALYSLFRSAPSAAAAAAATVVDSSRPSDRCKV-SCIGFNSNADSLKvqttifgtPCIGNSSSLQKCSARSLQPIKATAT 79 
168059389   2 IQSSAALGSSSLQASSSTRGDASISSSGGFAQK-SNVTYSADGSFMGs------lKGLKLSAAPVRRLAQRCSTTRATAT 74 
168059401   2 IRSSAALGSSSLRASSTSRGHVSVSTSGVCAQK-KNVSFSAEDSFAGs------vKSLRVAASPVSRSISRSFTVRATAT 74 
115469420   2 ASLAVPLRASAT-PAIAGTGSGGGSRAADPVKV-SCVRSKVTCGFPS--------------VGASSSLASSVEPVRATAT 65 
115444503   3 QQLSAPFRAAAA------AGSRASAAAADPAKV-LRLRSAGSAQFTS--------------IAASSSFARNIEPLRAIAT 61 
15219206    1 MALSSLLRSAAT-SAAAPRVELYPSSSYNHSQVtSSLGFSHSLTSSR---------FSGAAVSTGKYNAKRVQPIKATAT 70 
15219406    1 MAFSSLLRSAASYTVAAPRPDFFSSPASDHSKVlSSLGFSRNLKPSR--------FSSGISSSLQNGNARSVQPIKATAT 72 
242060660   2 AALSVPLRAAAV-------AAGSRAAGADPVKV-LCVRSTGSAHFGC----------AFPSITASSSVARNIEPLRAIAT 63 
224109070   1 MAFSCLLRSTPAAPLVEASRSDFSPSPSDRFKV-SSVSFNSLKSIFGt-------SIPTGSSSSQTCSGRSIQPIKATAT 72 
224101329   1 MAFSTLLRSTPAAPLIEASRSDFSPSPSDRFEV-SSIRFNSSKSIFGa-------SVPTGSSSLHTCSGRSIQPIKATAT 72 
255544534   1 MAFSCILRSTATSPLIEASRSDLSPSPSDPLQA-SSVNFNRDLKASKsff---gtSVPTASSSLEACSARSLQPIKATVT 76 
297844552   1 MAFSSLLRSAAT-SAAAPRFQLYPSSSYDHSQVtSSLGFTHNLASSR---------FSGAAVSTGKCNAKSVQPIKATAT 70 
297842739   1 MAFSSLLRSAAASTVATPRPDFFSSPASDHSKVfSSLGFSRNLKPSR--------FSSGISSSIQNCNARSVQPIKATAT 72 
225462254  80 ELPPTVQKSWSSGQTKIGINGFGRIGRLVLRVATSRDDIDVVAVNDPFVDAKYMAYMFKYDSTHGVFKGTIKVLDESTLE 159
168059389  75 EFPTKTTKSGSQEKVRIGINGCGRIGRLVLRVILARDDVEVVAVNDPFIDTKYMAYMLKYDSTHGLLKSEVNAVDDNTLQ 154
168059401  75 EFPVRTTKSGSQEKIRIGINGCGRIGRLVLRVILARDDVEVVAVNDPFIDTKYMAYLLKYDSTHGLLKSEVNAVDDNTLQ 154
115469420  66 QAPLATHQSSSTEKTKVGINGFGRIGRLVLRIATNRDDIEVVAVNDPFIDAKYMAYMFKYDSTHGPFKGTIKVVDESTLE 145
115444503  62 QAPPAVPQYSSGEKTKVGINGFGRIGRLVLRIATSRDDIEVVAVNDPFIDAKYMAYMFKYDSTHGPFKGSIKVVDDSTLE 141
15219206   71 EAPPAVHRSRSSGKTKVGINGFGRIGRLVLRIATFRDDIEVVAVNDPFIDAKYMAYMFKYDSTHGNYKGTINVIDDSTLE 150
15219406   73 EVPSAVRRSSSSGKTKVGINGFGRIGRLVLRIATSRDDIEVVAVNDPFIDAKYMAYMLKYDSTHGNFKGSINVIDDSTLE 152
242060660  64 QAPPAVPQYSSGEKTKIGINGFGRIGRLVLRIATSRDDIEVVAVNDPFVDAKYMAYMFKYDSTHGPFKGSIRVVDDSTLE 143
224109070  73 EMPPTVLKSRADGKTKIGINGFGRIGRLVLRVATFRDDIDVVAVNDPFIDANYMAYMFKYDSTHGVFSGTIKVLDDSNLE 152
224101329  73 EMPPTVLRSRADGKTKIGINGFGRIGRLVLRVATFRDDIDVVAVNDPFIDAEYMAYMFRYDSTHGVFNGTIKVLDDSTLE 152
255544534  77 EMPPTILKSRSDGRTKIGINGFGRIGRLVLRIATLRDDVDVVAVNDPFIDTKYMAYMLKYDSTHGLFKGHIKVVDESTLE 156
297844552  71 EAPPIVHRSRSSGKTKVGINGFGRIGRLVLRIATFRDDIEVVAVNDPFIDAKYMAYMFKYDSTHGNYKGTINVIDDSTLE 150
297842739  73 QVPSAVRRSSSSGKTKVGINGFGRIGRLVLRIATSRDDIDVVAVNDPFIDAKYMAYMLKYDSTHGNFKGSINVIDDSTLE 152
225462254 160 INGKQIKVTSKRDPSEIPWGDYGIDYVVESSGVFTTTEKASAHIKGGAKKVVISAPSADAPMFVVGVNETSYKPSMNIVS 239
168059389 155 VGSQTIKVFGCRDPAEIPWGSVGADFVVESTGVFTAVDKASAHFKGGAKKVVISAPSGDAPMFVMGVNQQSYKDSMNVVS 234
168059401 155 VGSQTIKVFGCRDPAEIPWGSVGADFVVESTGVFTAVDKASAHFKGGAKKVVISAPSGDAPMFVMGVNQQSYKDSMNVVS 234
115469420 146 INGKKISVTSKRDPSDIPWGNFGAEYVVESSGVFTTTEKASAHLKGGARKVVISAPSADAPMFVVGVNEKNYNPSMNVVS 225
115444503 142 INGKKVTITSKRDPADIPWGNFGAEYVVESSGVFTTTEKASAHLKGGAKKVVISAPSADAPMFVVGVNEKSYDPKMNVVS 221
15219206  151 INGKQVKVVSKRDPAEIPWADLGAEYVVESSGVFTTVGQASSHLKGGAKKVIISAPSADAPMFVVGVNEKTYLPNMDIVS 230
15219406  153 INGKKVNVVSKRDPSEIPWADLGADYVVESSGVFTTLSKAASHLKGGAKKVIISAPSADAPMFVVGVNEHTYQPNMDIVS 232
242060660 144 INGKKVTITSKRDPTEIPWGNFGAEYVVESSGVFTTIDKASAHLKGGAKKVVISAPSADAPMFVVGVNEKSYDPKMNVVS 223
224109070 153 INGKQIKITSKRDPTEIPWGDFGAEYVVESSGIFTTVEKAAAHMKVGAKKVVISAPSADAPMFVVGVNEKTYKPNMDIVS 232
224101329 153 INGKQIKITSKRDPAEIPWGDFGAEFVVESSGVFTTLEKAAAHKKGGAKKVVISAPSADAPMFVVGVNEKTYKPNMDVVS 232
255544534 157 INGKQIKVSSKRDPAEIPWGDHGAEYVVEASGVFTTIDKASAHKKGGAKKVVISAPSADAPMFVVGVNEQTYKPNMDIVS 236
297844552 151 INGKQVKVVSKRDPAEIPWADLGAEYVVESSGVFTTVGQASSHLKGGAKKVIISAPSADAPMFVVGVNEKTYQPNMDIVS 230
297842739 153 INGQKVNVVSKRDPAEIPWADLGADYVVESSGVFTTLSKAASHLKGGAKKVIISAPSADAPMFVVGVNEKTYQPNMDIVS 232
225462254 240 NASCTTNCLAPLAKVVHEEFGIVEGLMTTVHATTATQKTVDGPSMKDWRGGRGASQNIIPSSTGAAKAVGKVLPELNGKL 319
168059389 235 NASCTTNCLAPLAKVIQDNFGIEEGLMTTVHATTATQKTVDGPSGKDWRGGRGAGQNIIPSSTGAAKAVGKVLPELNGKL 314
168059401 235 NASCTTNCLAPLAKVIQDNFGIEEGLMTTVHATTATQKTVDGPSGKDWRGGRGAGQNIIPSSTGAAKAVGKVLPELNGKL 314
115469420 226 NASCTTNCLAPLAKIVHEEFGIAEGLMTTVHATTATQKTVDGPSMKDWRGGRGASQNIIPSSTGAAKAVGKVLPALNGKL 305
115444503 222 NASCTTNCLAPLAKVVHEEFGIVEGLMTTVHATTATQKTVDGPSMKDWRGGRGAAQNIIPSSTGAAKAVGKVLPELNGKL 301
15219206  231 NASCTTNCLAPLAKVVHEEFGILEGLMTTVHATTATQKTVDGPSMKDWRGGRGASQNIIPSSTGAAKAVGKVLPELNGKL 310
15219406  233 NASCTTNCLAPLAKVVHEEFGILEGLMTTVHATTATQKTVDGPSMKDWRGGRGASQNIIPSSTGAAKAVGKVLPELNGKL 312
242060660 224 NASCTTNCLAPLAKVVHEEFGIVEGLMTTVHATTATQKTVDGPSMKDWRGGRGAGQNIIPSSTGAAKAVGKVLPELNGKL 303
224109070 233 NASCTTNCLAPLAKVVHEEFGIIEGLMTTVHATTATQKTVDGPSRKDWRGGRGAAQNIIPSSTGAAKAVGKVLPELNGKL 312
224101329 233 NASCTTNCLAPLAKVVHEEFGILEGLMTTVHATTATQKTVDGPSMKDWRGGRGAAQNIIPSSTGAAKAVGKVLPELNGKL 312
255544534 237 NASCTTNCLAPLAKVVHEEFGIVEGLMTTVHATTATQKTVDGPSMKDWRGGRGAGQNIIPSSTGAAKAVGKVLPELNGKL 316
297844552 231 NASCTTNCLAPLAKVVHEEFGILEGLMTTVHATTATQKTVDGPSMKDWRGGRGASQNIIPSSTGAAKAVGKFLPELNGKL 310
297842739 233 NASCTTNCLAPLAKVVHEEFGILEGLMTTVHATTATQKTVDGPSMKDWRGGRGASQNIIPSSTGAAKAVGKVLPELNGKL 312
225462254 320 TGMAFRVPTPNVSVVDLTCRLKKSATYEDVKAAVKYASEGPLKGILGYTDEDVVSNDFVGDSRSSIFDAKAGIGLSASFM 399
168059389 315 TGMAFRVPTPNVSVVDLTVRLQKSGSYEDIKAAIKAASEGPMNGILGYTEDDVVSNDFVGDARSSIFDAKAGIALSDKFV 394
168059401 315 TGMAFRVPTPNVSVVDLTVRLQKSGSYEDIKAAIKAASEGPMYGILGYTEDDVVSNDFVGDARSSIFDAKAGIALSDKFV 394
115469420 306 TGMAFRVPTPNVSVVDLTCRLEKSASYEDVKAAIKEASEGSLKGILGYTDEDVVSNDFIGDTRSSIFDAKAGIGLSSSFM 385
115444503 302 TGMAFRVPTPNVSVVDLTCRIEKSASYDDVKAAIKAASEGALKGILGYTDEDVVSNDFVGDARSSIFDAKAGIGLSSSFM 381
15219206  311 TGMAFRVPTPNVSVVDLTCRLEKDASYEDVKAAIKFASEGPLRGILGYTEEDVVSNDFLGDSRSSIFDANAGIGLSKSFM 390
15219406  313 TGMAFRVPTSNVSVVDLTCRLEKGASYEDVKAAIKHASEGPLKGILGYTDEDVVSNDFVGDSRSSIFDANAGIGLSKSFV 392
242060660 304 TGMAFRVPTPNVSVVDLTCRIEKSASYDDVKAAIKAASEGALKGILGYTDEDVVSNDFVGDSRSSIFDAKAGIGLSSSFM 383
224109070 313 TGMAFRVPTPNVSVVDLTCRLEKSASYEDVKAAIKYASEGPLKGILGYTDDDVVSSDFLGDSRSSIFDAKAGIGLSASFM 392
224101329 313 TGMAFRVPTPNVSVVDLTCRLEKSASYEDVKAAIKYASEGPLMGILGYTDDDVVSNDFVGDSRSSIFDAKAGIGLSASFM 392
255544534 317 TGMAFRVPTPNVSVVDLTCRLEKSASYEDVKAAIKYASEGPLKGILGYTDEDVVSNDFVGDSRSSIFDAKAGIGLSAAFM 396
297844552 311 TGMAFRVPTPNVSVVDLTCRLEKDASYEDVKAAIKFASEGPLRGILGYTEEDVVSNDFLGDSRSSIFDANAGIGLSKSFM 390
297842739 313 TGMAFRVPTSNVSVVDLTCRLEKGASYEDVKAAIQYASEGPLKGILGYTDEDVVSNDFVGDSRSSIFDANAGIGLSKSFV 392
225462254 400 KLVAWYDNEWGYSNRVLDLIEHMALVAASK 429
168059389 395 KLVSWYDNEWGYSNRVVDLILHMAGVKANL 424
168059401 395 KLVSWYDNEWGYSNRVVDLILHMAGVKANL 424
115469420 386 KLVSWYDNEWGYSNRVLDLIGHMALVNAKP 415
115444503 382 KLVSWYDNEWGYSNRVLDLIAHMALVNAKH 411
15219206  391 KLVSWYDNEWGYSNRVLDLIEHMALVAASR 420
15219406  393 KLVSWYDNEWGYSNRVLDLIEHMALVAASH 422
242060660 384 KLVSWYDNEWGYSNRVLDLIAHMALVSAKH 413
224109070 393 KLVSWYDNEWGYSNRVLDLIEHMALVAAHN 422
224101329 393 KLVSWYDNEWGYSNRVLDLIEHMALVAAHN 422
255544534 397 KLVSWYDNEWGYSNRVLDLIEHMALVAAQN 426
297844552 391 KLVSWYDNEWGYSNRVLDLIEHMALVAASC 420
297842739 393 KLVSWYDNEWGYSNRVLDLIEHMALVAASH 422
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap