Conserved Protein Domain Family
PLN02270

?
PLN02270: PLN02270 
phospholipase D alpha
Statistics
?
PSSM-Id: 165912
View PSSM: PLN02270
Aligned: 8 rows
Threshold Bit Score: 1769.47
Threshold Setting Gi: 297853014
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15219031    1 MEECLLHGRLHATIYEVDHLHAEGGrSGFLGSILANVEETIGVGKGETQLYATIDLEKARVGRTRKITKEPKNPKWFESF 80 
15232671    1 MAQHLLHGTLHATIYEVDALHGGGVrQGFLGKILANVEETIGVGKGETQLYATIDLQKARVGRTRKIKNEPKNPKWYESF 80 
225442981   4 FNEIPLHGTLHATIFEIDRLHSGGA-PKFFRKLVENIEETVGFGKGTSKLYATIDIGRARVGRTRMIENEPSNPRWYESF 82 
224134947   1 MAQVLLHGTLHVTIFEVDKLGDGGG-HGFLHKLVENIGEKVGIGDGISKLYATIDLERARVGRTRILEKEATNPRWNESF 79 
224059184   1 MAQILLHGNLHVTIYEVDKIGEGGG-HGFFHKLVGKVGEKVGIGNGISRLYATIDLEKARVGRTRILENEATNPRWYESF 79 
255553165   1 MAQISLHGTLHVTIYEVDKLHSGGG-PHFFRKLVENIEETVGFGKGVSKLYATIDLEKARVGRTRILENEQSNPRWYESF 79 
297853014   1 MEEFLLHGRLHATIYEVDRLHAEGGrSGFLGSILANVEETIGVGKGETQLYATIDLEKARVGRTRKITKEPKNPKWFESF 80 
297830154   1 MAQHLLHGTLHATIYEVDALHGGGVrQGFLGKILANVEETIGVGKGETQLYATIDLQKARVGRTRKIKNEPKNPKWYESF 80 
15219031   81 HIYCGHMAKHVIFTVKDANPIGATLIGRGYIPVEDILHGEEVDRWVDILDNEKNPIAGGSKIHVKLQYFGVEKDKNWNRG 160
15232671   81 HIYCAHLASDIIFTVKDDNPIGATLIGRAYIPVDQVINGEEVDQWVEILDNDRNPIQGGSKIHVKLQYFHVEEDRNWNMG 160
225442981  83 HIYCAHMAGHIIFTVKDDNPIGATLIGRASVPIQEILGGEEVDKWVEIVNEELKPIHGGSKIHVKLQYFEVTADRSWGRG 162
224134947  80 HIYCAHMASNIVFTVKDDNPIGATLIGRAYIPVQEIVDGEEIDRWVEMLDEDKNPIQSSSKIHVKLQYFDVTKDRNWGGG 159
224059184  80 HIYCAHMASNVIFTVKDVNPIGATLIGRAYIPVEEILDGEEIDRWVEILDGDKNPIRAGSKIHVKLQYFDITNDHNWGRG 159
255553165  80 HVYCAHQASNVIFTVKDDNPIGATLIGRAYVPVEELLDGEEIDRWVEILDEDKNPVHSGSKIHVKLQYFEVTKDRNWGQG 159
297853014  81 HIYCGHMAKHVIFTVKDANPIGATLIGRGYIPVEDILHGEEVDRWVDILDNDKNPIAGGSKIHVKLQYFGVEKDKNWNRG 160
297830154  81 HIYCAHLASDIIFTVKDDNPIGATLIGRAYIPVDEVINGEEVDRWVEILDNDRNPIHGGSKIHVKLQYFHVEEDRNWNKG 160
15219031  161 IKSAKFPGVPYTFFSQRRGCKVSLYQDAHIPGNFVPKIPLAGGKNYEPHRCWEDIFDAITNAKHLIYITGWSVYTEISLV 240
15232671  161 IKSAKFPGVPYTFFSQRQGCKVSLYQDAHIPDNFVPRIPLAGGKNYEPQRCWEDIFDAISNAKHLIYITGWSVYAEIALV 240
225442981 163 IRSLKFPGVPFTFFSQRKGCHVSLYQDAHVPDNFVPKIPLADGKYYEPRRCWEDVFDAINNAKHLIYITGWSVYTEITLV 242
224134947 160 IRSAKYPGVPYTFYPQRQGCKVSLYQDAHVPDKFIPKIPLASGEHYNPHRCWEDVFDSITNAKHFIYITGWSVYTEISLV 239
224059184 160 IRGSKYPGVPYTFYSQRQGCRVSLYQDAHIPDKFIPKIPLASGEYYEPHRCWEDVFDAITNAKHLIYITGWSVYTEISLV 239
255553165 160 IRSSKYPGVPYTYFSQRQGCKVSLYQDAHIPDKFVPQIPLAGGNYYEPHRCWEDVFDAITNAKHLIYITGWSVYTEISLI 239
297853014 161 IKSAKFPGVPYTFFSQRRGCKVSLYQDAHIPGNFVPKIPLAGGKNYEPGRCWEDIFDAITNAKHLIYITGWSVYTEISLV 240
297830154 161 IKSAKFPGVPYTFFSQRQGCKVSLYQDAHIPDNFVPRIPLAGGKNYEPQRCWEDIFDAISNAKHLIYITGWSVYAEIALV 240
15219031  241 RDSRRPKQGGDVTVGELLKKKASEGVKVILLVWDDRTSVDLLKKDGLMATHDEETENFFRGTDVNCILCPRNPDDGGSIV 320
15232671  241 RDSRRPKPGGDVTIGELLKKKASEGVRVLLLVWDDRTSVDVLKKDGLMATHDEETENFFRGSDVHCILCPRNPDDGGSIV 320
225442981 243 RDSRRPKPGGDLTIGELLKKKASEGVRVLMLVWDDRTSVPLLKKDGLMGTHDEETEHYFHDTDVHCVLCPRNPDDGGSIV 322
224134947 240 RDSRRPKPGGDITLGELLKKKASEGVRVLILIWDDRTSVDLLKKDGLMATHDEETENYFQNTDVHCVLCPRNPDDGGSIV 319
224059184 240 RDSRRPKPGGDITLGELLKKKASEGVRVLMLIWDDRTSVGLLKRDGLMATHDEETEHYFQNTDVHCILCPRNPDDGGSIV 319
255553165 240 RDSRRPKPGGDITLGELLKKKASEGVRVLMLVWDDRTSVGLLKKDGLMATHDEETEHFFQNTDVHCVLCPRNPDDGGSFV 319
297853014 241 RDSRRPKQGGDVTIGELLKKKASEGVKVILLVWDDRTSVDLLKKDGLMATHDEETENFFRGTDVNCILCPRNPDDGGSIV 320
297830154 241 RDSRRPKPGGDVTIGELLKKKASEGVRVLLLVWDDRTSVDVLKKDGLMATHDEETENFFRGSDVHCILCPRNPDDGGSIV 320
15219031  321 QNLQISTMFTHHQKIVVVDSEMPS-GGSRSRRIVSFVGGLDLCDGRYDTPFHSLFRTLDTAHHDDFHQPNFTGAAITKGG 399
15232671  321 QSLQISTMFTHHQKIVVVDSEMPSrGGSEMRRIVSFVGGIDLCDGRYDTPFHSLFRTLDTVHHDDFHQPNFTGAAITKGG 400
225442981 323 QDLQISTMFTHHQKIVVVDSEMPS-GGSEKRRIVSFVGGIDLCDGRYDTQFHSLFRTLDTAHHDDFHQPNFEGASIQKGG 401
224134947 320 QDLQISTMFTHHQKIVVVDSAMPN-GDSQRRRIVSYVGGIDLCDGRYDTPFHSLFRTLDTAHHDDFHQPNFTGASIQKGG 398
224059184 320 QDLQISTMFTHHQKIVVVDSAMPN-GDSQRRRIVSYIGGIDLCDGRYDTPFHSLFRTLDTAHHDDFHQPNFTGASIQKGG 398
255553165 320 QDLQISTMFTHHQKIVVVDSAMPN-GDSQRRRIVSFVGGLDLCDGRYDSPFHSLFRTLDSAHHDDFHQPNFAGASIEKGG 398
297853014 321 QNLQISTMFTHHQKIVVVDSEMPS-GGSRSRRIVSFVGGLDLCDGRYDTPFHSLFRTLDTAHHDDFHQPNFTGAAITKGG 399
297830154 321 QSLQISTMFTHHQKIVVVDSEMPNrGGSEMRRIVSFVGGIDLCDGRYDTPFHSLFRTLDTVHHDDFHQPNFTGATITKGG 400
15219031  400 PREPWHDIHCRLEGPIAWDVLYNFEQRWSRQGGKDILVKMRELGDIIIPPSPVLFSEDHDVWNVQLFRSIDGGAAAGFPD 479
15232671  401 PREPWHDIHSRLEGPIAWDVMYNFEQRWSKQGGKDILVKLRDLSDIIITPSPVMFQEDHDVWNVQLFRSIDGGAAAGFPE 480
225442981 402 PREPWHDIHSRLEGPIAWDVLFNFEQRWRKQGGKDILLQLRDLDDVIIPPSPVMFPDDQEVWNVQLFRSIDGGAAFGFPE 481
224134947 399 PREPWHDIHSRLEGPIAWDVLFNFEQRWKKQGGKDLLVQLRELEDVIIPPSPAMFPDDHETWNVQLFRSIDGGAAFGFPE 478
224059184 399 PREPWHDIHSRLEGPIAWDVLFNFEQRWKKQGGKDLLVQLRELEDVIIPPSPVTYPDDHETWNVQLFRSIDGGAAFGFPE 478
255553165 399 PREPWHDIHSRLEGPIAWDVLFNFEQRWRKQGGKDLLIQLRELEDVIIPPSPVMYPDDFEAWNVQLFRSIDGGAAFGFPE 478
297853014 400 PREPWHDIHCRLEGPIAWDVLYNFEQRWSRQGGKDILVKIRDLGDIIIPPSPVLFSEDHDVWNVQLFRSIDGGAAAGFPD 479
297830154 401 PREPWHDIHSRLEGPIAWDVMYNFEQRWSKQGGKDILVKLRDLGDIIITPSPVMFQEDHDVWNVQLFRSIDGGAAAGFPE 480
15219031  480 SPEAAAEAGLVSGKDNIIDRSIQDAYIHAIRRAKDFIYIENQYFLGSSFAWSAD-GIKPEEINALHLIPKELSLKIVSKI 558
15232671  481 SPEAAAEAGLVSGKDNIIDRSIQDAYIHAIRRAKDFIYVENQYFLGSSFAWAAD-GITPEDINALHLIPKELSLKIVSKI 559
225442981 482 TPEEAARAGLVSGKDNIIDRSIQDAYINAIRRAKDFIYIENQYFLGSSFGWAPDeGIKIEDVGALHLIPKELSLKIASKI 561
224134947 479 TPEDAAKAGLVSGKDNIIDRSIQDAYVNAIRRAKNFIYIENQYFLGSSFSWSAD-DIKPEDINALHLIPKELSLKIVSKI 557
224059184 479 TPEDAAKAGLVSGKDNIIDRSIQDAYINAIRRAKNFIYIENQYFLGSSFCWSAD-GIKPEDINALHLIPKELSLKIVSKI 557
255553165 479 TPEDAARAGLVSGKDNIIDRSIQDAYIHAIRRAKNFIYIENQYFLGSSFGWSPD-GIKPEDINALHLIPKELSLKILSKI 557
297853014 480 SPEAAAEAGLVSGKDNIIDRSIQDAYIHAIRRAKDFIYIENQYFLGSSFAWSAD-GIKPEEINALHLIPKELSLKIVSKI 558
297830154 481 SPEAAAEAGLVSGKDNIIDRSIQDAYIHAIRRAKDFIYVENQYFLGSSFAWAAD-GITPEDINALHLIPKELSLKIVSKI 559
15219031  559 KAGEKFKVYVVVPMWPEGIPESGSVQAILDWQKRTMEMMYKDVIKALRENGLEgEDPRDYLTFFCLGNREVKKDGEYEPS 638
15232671  560 EKGEKFRVYVVVPMWPEGLPESGSVQAILDWQRRTMEMMYKDVIQALRAQGLE-EDPRNYLTFFCLGNREVKKDGEYEPA 638
225442981 562 EAGEKFTVYIVVPMWPEGMPESGSVQAILDWQRRTMEMMYKDIIKALADKGIE-DDPRNYLTFFCLGNREVKKSGEYEPS 640
224134947 558 EAGERFTVYVVVPMWPEGIPESGSVQAILDWQRRTLEMMYKDVIEALRAKGLE-EDPRNYLTFFCLGNREVKKSGEYEPS 636
224059184 558 EAGERFTVYVVVPMWPEGIPESASVQAILDWQRRTMDMMYKDVIQALRAKGLE-EDPRNYLTFFCLGNREVKKSGEYEPS 636
255553165 558 AAGERFTVYIVVPMWPEGIPESASVQAILDWQKRTMEMMYKDIVQALKANGII-EDPRNYLTFFCLGNREVKKSGEYEPA 636
297853014 559 KAGEKFKVYVVVPMWPEGIPESGSVQAILDWQKRTMEMMYKDVIKALRETGLEgEDPRDYLTFFCLGNREVKKDGEYEPS 638
297830154 560 EKGEKFRVYVVVPMWPEGLPESGSVQAILDWQRRTMEMMYKDVIQALRAQGLE-EDPRNYLTFFCLGNREVKKDGEYEPA 638
15219031  639 EKPEPDTDYIRAQEARRFMIYVHTKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGGYQPYHLSTRQPARGQIHGFRMS 718
15232671  639 EKPDPDTDYMRAQEARRFMIYVHTKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGGYQPHHLSHRQPARGQIHGFRMS 718
225442981 641 EHPEPDTDYSRAQEARRFMIYVHAKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGGYQPYHLASRQPARGQIHGFRMS 720
224134947 637 EKPEPDSDYIRAQEARRFMIYVHAKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGGYQPYHLATRQPARGQIHGFRLG 716
224059184 637 EKPEPDSDYIRAQEARRFMIYVHAKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGGYQPYHLATRQPARGQIHGFRLG 716
255553165 637 EKPEPDTDYIRAQEARRFMIYVHTKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGAYQPHHLSTRQPARGQIHGFRMS 716
297853014 639 EKPEPDTDYIRAQEARRFMIYVHTKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGGYQPYHLSTRQPARGQIHGFRMS 718
297830154 639 EKPDPDTDYMRAQEARRFMIYVHTKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGGYQPHHLSHRQPARGQIHGFRMS 718
15219031  719 LWYEHLGMLDETFLDPSSQECIQKVNRVADKYWDLYSSESLEHDLPGHLLRYPIGIASEGNITELPGCEFFPDTKARILG 798
15232671  719 LWYEHLGMLDETFLDPSSLECIEKVNRISDKYWDFYSSESLEHDLPGHLLRYPIGVASEGDITELPGFEFFPDTKARILG 798
225442981 721 LWYEHLGMLDESFLQPESKECIQKVNQIAEKYWDLYASETLEHDLPGHLLRYPIAVSCGGDITELPGAEFFPDTKARVLG 800
224134947 717 LWYEHLGMLDDTFLHPESEECVTKVNQITDKYWDLYSSETLEHDLPGHLLRYPIGVSSEGNVTELPGTEFFPDTKARVLG 796
224059184 717 LWYEHLGMLDDTFLKPENEDCIRKVNQIADKYWDLYSSETLEGDLPGHLLRYPIGISSEGNVTELPGTEYFPDTKARVLG 796
255553165 717 LWYEHLGMLDESFLNPESEECVRKVNQMAEKYWDLYSSETLEHDLPGHLLRYPIGVASEGDVTELPGTEFFPDTKARVLG 796
297853014 719 LWYEHLGMLDETFLDPSSQECIQKVNRVADKYWDLYSSESLEHDLPGHLLRYPIGIASEGNITELPGCEFFPDTKARILG 798
297830154 719 LWYEHLGMLDETFLDPSSLECIEKVNRISDKYWDFYSSESLEHDLPGHLLRYPIGVASEGDITELPGFEFFPDTKARILG 798
15219031  799 VKSDYMPPILTT 810
15232671  799 TKSDYLPPILTT 810
225442981 801 TKSEYLPPILTT 812
224134947 797 AKSDYMPPILTT 808
224059184 797 AKSDYMPPILTT 808
255553165 797 AKSDYLPPILTT 808
297853014 799 AKSDYMPPILTT 810
297830154 799 TKSDYLPPILTT 810
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap