Conserved Protein Domain Family
PLN02268

?
PLN02268: PLN02268 
probable polyamine oxidase
Statistics
?
PSSM-Id: 177909
View PSSM: PLN02268
Aligned: 27 rows
Threshold Bit Score: 649.056
Threshold Setting Gi: 302813146
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
302819444   1 PSVVIIGAGIAGIAAARALQDRGIEVTLLESSARIGGRIHTDKSslttpggTAVPVDMGASWIHGATPgHNPIAtAALDV 80 
115461238  26 PSVIVIGGGISGIAAARALSNASFKVTLLESRDRLGGRVHTDYS-------FGCPIDMGASWLHGVCN-ENSLA-PLIRL 96 
15218830   29 PSVIVIGSGISGLAAARNLSEASFKVTVLESRDRIGGRIHTDYS-------FGCPVDMGASWLHGVSD-ENPLA-PIIRR 99 
225430586  26 PSVIVIGGGISGIAAAHTLHNASFQVVLLESRDRLGGRIHTDYS-------LGCPVDMGASWLHGACN-ENPLA-PLICR 96 
242077616  25 PSVIVIGGGISGIAAARALSNASFKVTLLESRDRVGGRVHTDYS-------FGCPIDMGASWLHGVCN-ENSLA-PLIRM 95 
242077612  24 PSVIVIGGGISGVAAARALSNSSFKVTVLESRDRIGGRVHTDYS-------FGCPIDMGASWLHGVCN-ENSLA-PLIGY 94 
224135207  15 PTVIVIGGGISGLAAARMLHDASFKVILLESRDRLGGRIHTDYS-------FGYPVDLGASWLHGVCN-ENPLA-PLIRG 85 
224079714  22 PTVIVIGGGISGLAAARRLHDASFKVILLESRDRLGGRIHTDHS-------FGYPVDLGASWLHGVCN-ENPLA-PLIRG 92 
255570451  31 PSVIVIGAGISGLAAARVLYDASFKVILLESRDRLGGRIHTDYS-------FGYPVDLGASWLHGVCN-ENPLA-PLIRS 101
297838203  29 PSVIVIGSGISGLAAARNLSEASFKVTVLESRDRIGGRIHTDYS-------FGCPVDMGASWLHGVSD-ENPLA-PIIRR 99 
302819444  81 LQLATHQTAGEGSLLYDHDVQrGFALYTRDGVRIPRDTVRQFESWFRAAVEA-ERRDARYESDASLEDTINRMVAEH--- 156
115461238  97 LGLRLYRTSGDNSVLYDHDLE-SYALFDKDGRQVPQEIVTKVGETFEKILKEtVKVRAEHEDDMPLIQAISIVLDRNphl 175
15218830  100 LGLTLYRTSGDDSILYDHDLE-SYGLFDMHGNKIPPQLVTKVGDAFKRILEEtEKIRDETANDMSVLQGISIVLDRNpel 178
225430586  97 LGLTLYRTSGDDSVLYDHDLE-SCTLFDMDGHQVPQKMVVEVGETFKKILKEtENVRIEHCDDMSVLQAISIVLDRHpel 175
242077616  96 LGLRLYRTSGDNSVLYDHDLE-SYALFDKHGQQVPQEIVSKVGETFEKILKEtVKVRDEHANDMPLIQAMAIVLNRNphm 174
242077612  95 LGLRLYRTSDDNSVLYDHDLE-SYALFDKDGNQVPKETVDKVGETFERILEEtVKVRDEQEHDMPLLQAISIVFERHphl 173
224135207  86 LGLKLYRTSGDNSVLYDHDLE-SYTLFDKEGRQVPQQMVIEVGDTFKRILEEtEKVRDEHTDDMSVLQAIWIVLDKHpel 164
224079714  93 LGLKLYRTSGDNSVLYDHDLE-SYTLFDKEGHKIPQQMVIEVGDAFKRILDEtEKVRDEHTDDMSVLQAIWIVLDRHpel 171
255570451 102 LRLTLYKTSGDNSVLYDHDLE-SCTLFDMNGHQVPKELVIEVGDIFKRILKEtERIRDEHPDDMSILQAIKLVLDRHsel 180
297838203 100 LGLTLYRTSGDDSILYDHDLE-SYGLFDMRGNKIPPQLVTEVGDAFKRILEEtEKIRDETTDDMSVLQGISIVLDRNpel 178
302819444 157 KLQGsVDEEILGFYVCRIEGWFAADSSRISPKSWIE---EEFHEGGHLLVSKGYSQLVESLARGIDIRLGH-RAVRVTQQ 232
115461238 176 KLDG-LQYEVLQWCICRLEAWFATDVDNISLKNWDQ---EHVLTGGHGLMVHGYDPVIKALAQDLDIHLNH-RVTKIIQR 250
15218830  179 RQEG-MAYEVLQWYLCRMEAWFAVDANLISLKCWDQ---DECLSGGHGLMVQGYEPVIRTIAKDLDIRLNH-RVTKVVRT 253
225430586 176 RQEG-LANEVLQWYICRMEAWFAVDADMISLKSWDQ---EHILSGGHGLMVQGYDPIIKTLSKDLDIRLNH-RVTNISYG 250
242077616 175 KLEG-LEYEVLQWCICRLEAWFATDMDNISLKNWDQ---EHVLTGGHGLMVNGYDPVIKALAQGLDIHLNH-RVTKIIQR 249
242077612 174 KLEG-LDDQVLQWCVCRLEAWFAADADEISLKNWDQ---ERVLTGGHGLMVNGYYPVIEALAQGLDIRLNQ-RVTEITRQ 248
224135207 165 RQEG-LAYEVLQWYICRMEAWFAADADMISLKSWDQ---A-ILSGGHGLMVQGYDPIIKALAKDIDIQLNHsRVTKISNG 239
224079714 172 RQEG-LAYEVLQWYICRMEAWFAADADMISLKSWDQ---EQVLSGGHGLMVQGYDPIIKALAKDIDIRLNH-RVAKISNG 246
255570451 181 RQEG-IANEVFQWYICRMEAWFAVDADMISLKMWDQaseENVLCGGHGLMVQGYDPIIKALAKDIDIRLNH-KVTKICNA 258
297838203 179 RLQG-IAYEVLQWYLCRMEAWFAVDANLISLKCWDQ---DECLSGGHGLMVQGYEPVIRTIAKDLDIRLSH-RVTKVVRT 253
302819444 233 MPGlgicskphVQVSCKNGIEIRADAAIVAVPLGILQSNVIDFQPELPEWKRDAISSLEVGHQNKIALLFESLFWdEDAE 312
115461238 251 YNK--------TIVCVEDGTSFVADAAIITVPLGVLKANIIKFEPELPDWKLSSISDLGIGIENKIALRFNSVFW-PNVE 321
15218830  254 SNNk-------VIVAVEGGTNFVADAVIITVPIGVLKANLIQFEPELPQWKTSAISGLGVGNENKIALRFDRAFW-PNVE 325
225430586 251 CKK--------VVVTVEGGRNFVADAAIITVPIGILKANLIEFKPKLPDWKVNAISDIGVGNENKIALRFDDVFW-PNVE 321
242077616 250 YNK--------VIVCVEDGASFVADAAIITVPLGVLKANIIKFEPELPREKLSAIADLGVGIENKIALKFNTVFW-PNVE 320
242077612 249 YNG--------VKVTTEDGTSYFADACIISVPLGVLKANVIKFEPELPSWKSSAIADLGVGVENKIAMHFDRVFW-PNVE 319
224135207 240 PNK--------VMVTVEDGTGFIADAAIITVPLGILKANLIHFEPKLPQWKVDAISDLGFGCENKIALQFDKVFW-PDLE 310
224079714 247 PNK--------VMVTVEDGTGFIADAAIITVPLGILKANLIHFEPKLPQWKVDAISDLGFGSENKIAMQFDRVFW-PDVE 317
255570451 259 LNK--------AMVVVEDGRNFIADAVIVTVPLGILKANLIQFEPKLPDWKVAAISDLGVGSENKIALQFDEVFW-PNVE 329
297838203 254 SNNk-------VIVAVEGGTNFVADAVIITVPIGVLKANLIQFEPELPQWKTSAISGLGVGNENKIALRFDRAFW-PNVE 325
302819444 313 FLGCATGAPRGCSYFLSLYPTLRRAVLVYMPVGELSRRIERMGDEEATAFAMEKVRAMLPGAPDPVSSLISRWSLDENFL 392
115461238 322 VLGRVAPTSNACGYFLNLHKATGHPVLVCMVAGRFAYEFEKLSDEESVNFVMSQLKKMLPGATEPVQYLVSRWGTDPNSL 401
15218830  326 FLGMVAPTSYACGYFLNLHKATGHPVLVYMAAGNLAQDLEKLSDEATANFVMLQLKKMFPDAPDPAQYLVTRWGTDPNTL 405
225430586 322 LLGIVAPTSYACGYFLNLHKATGYPILVYMTAGSSACGLEKLSDECAVNFVMLQLKKMFPDATKPVQYLVSRWGTDPNSL 401
242077616 321 VLGRIAPTSNACGYFLNLHKATGNPVLVCMVAGRFAYEIEKLSDEESVNFVMSQLRKMLPQATEPVQYLVSRWGSDPNSL 400
242077612 320 VLGMVGPTPKACGYFLNLHKATGNPVLVYMAAGRFAQEVEKLSDKEAVSLVVSHLKKMLPDASEPTQYLVSRWGSDPNSL 399
224135207 311 LLGIVAPTSYACGYFLNLHKATGHPVLVYMAAGRFAYDLEKLSDESAAKFVMLQLKKMFPNATEPVQYLVTRWGTDPNSL 390
224079714 318 LLGVVAPTSYACGYFLNLHKATGHPVLVYMAAGRFACDLEKLSDESAANFVMLQLKKMFPNATEPVQYLVTRWGTDPNSL 397
255570451 330 LLGIVAPTSYACGYFLNLHKATGHPVLVYMAAGRFAYDLEKLSDESAATFVMLQLKKMFPHATDPVRYLVTRWGTDPNSL 409
297838203 326 FLGMVAPTSYACGYFLNLHKATGHPVLVYMAAGNLAQDLEKLSDEATANFVMLQLKKMFPDAPDPAQYLVTRWGTDPNTL 405
302819444 393 CCYSNDPSPNGSDLFERMAMPASELlYFAGEASSP-DFSGTVHGAYESGVAAAEQIVESLS 452
115461238 402 GSYSCDLVGKPADLYERFCAPVGNL-FFAGEAACI-DHSGSVHGAYSSGIVAAEDCRRHLS 460
15218830  406 GCYAYDVVGMPEDLYPRLGEPVDNI-FFGGEAVNV-EHQGSAHGAFLAGVSASQNCQRYIF 464
225430586 402 GCYAHDVVGKPEDSYERLLEPLDNL-FFGGEAVSL-DHQGSVHGAYSAGIMAAENCQRYIL 460
242077616 401 GSYSCDLVGKPADLYERFCAPVGNL-FFAGEAACI-DHSGSVHGAYSSGIAAAEDCRRRLS 459
242077612 400 GSYSCDLVGKPADVCARFSAPVDNL-YFAGEAASA-EHSGSVHGAYSSGIAAAEECRKRLL 458
224135207 391 GCYSYDLVGKPEDSYERLRAPLGNL-FFGGEAVSMeDHQGSVHGAYSAGIMAAESCQRHLL 450
224079714 398 GCYSYDLVGKPGDSYERLRAPLGNL-FFGGEAVSMeDHQGSVHGAYSAGIMAAENCQGHIL 457
255570451 410 GCYTYDVVGKPDDLYDRLRAPLGNL-FFGGEAVSM-DHQGSVHGAYASGLMAAENCQRHVL 468
297838203 406 GCYAYDVVGMPEDLYPRLGEPVDNI-FFGGEAVNV-EHQGSAHGAFLAGVTASQNCQRYIF 464
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap