Conserved Protein Domain Family
PLN02263

?
PLN02263: PLN02263 
serine decarboxylase
Statistics
?
PSSM-Id: 177904
View PSSM: PLN02263
Aligned: 12 rows
Threshold Bit Score: 852.571
Threshold Setting Gi: 302844899
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
242055685   1 MAPVVVELMTTTARDLQLADDTAAAaHQQARVHQVGEDDEEGIKLAMAAAPAAEAFAVQEPPADEEALAERQAEVARLLA 80 
15218445   15 TLIEKLDILSDDFDPTAVVTEPLPP-PVTNGIGADKGGGGGEREMVLGRNIHTTSLAVTEPEVNDEFTGDKEAYMASVLA 93 
224082428  10 HVNGKAEIEDFDI------SAVVQPePLPPIVAAENGDKQNGREIVLGKNVHTTCLEVTEPEANDEFTGDKEAYMASVLA 83 
224066727  10 HLNGKVEIEDFDL----------------TVVEAENGDKQNGREIVLGRNVHTTCLEVTEPEANDESTGDKEAYMASVLA 73 
225463912  13 DLGGKVEILSEDFDPTAVVVEPVPPvVENGGEMGREEEEKRSKEIVLGRNVHTTCLAVTEPDANDEFTGDKEAYMASVLA 92 
242061884  26 PLHPAEAAAAVETLPMELEPPEALVaAAAEAKREEAGANGRRRVIVMGRNVHTSCFAVKEPDADDEETGEREATMASVLA 105
255584582   9 HVNGKKTEEILREDIDLDLTAIVAAePLPEVV-------ENEREIVLGKNVHTSCLEVTEPDADDELTGDKDAYMASVLA 81 
297852162  15 SLIEKLDILSDDFDPTAVVTEPLPSpT-------ELNGGGGEREMVLGRNIHTTSLAVTEPEVNDEFTGDKEAYMASVLA 87 
302844899  11 AMPPVLSRSAVTEQPKTLRSAHLKVdTYNVAAVAPYQAMPVAGPVITHHKSTALPVMEPHPEMTEE---EREARIAEMIG 87 
302810902  13 VLPEEISIDSCGIEPDLEGADAI-------------GKLRGEREIVLGRNLHDQCFSITEPEHDDEETGEKDVYMAGVLA 79 
302788929  13 VLPEEISIDSCGIEPDLEDADAI-------------GKLRGEREIVLGRNLHDQCFSITEPEHDDEETGDKDVYMAGVLA 79 
297599383     --------------------------------------------------------------------------------    
242055685  81 GFRRHLEDRSAHHLGYPYNLDFDFASLAPfLQGLCINNLGDPFVESNYGVHSRPLEVAVLDWFARLWDLGPGDYWGYVTS 160
15218445   94 RYRKTLVERTKNHLGYPYNLDFDYGALGQ-LQHFSINNLGDPFIESNYGVHSRPFEVGVLDWFARLWEIERDDYWGYITN 172
224082428  84 RYRKNLMERTKYHLGYPYNLDFDYGALGQ-LQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWEIEKNEYWGYITN 162
224066727  74 RYRKNLMERTKHHLGYPYNLDFDYGALGQ-LQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWEIEKSEYWGYITN 152
225463912  93 RYRKTLMERTKHHLGYPYNLDFDYGALSQ-LQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWEIEKDEYWGYITN 171
242061884 106 LYRRSLVERTKHHLGYPYNLDFDYGALAQ-LQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWELEKDEYWGYITN 184
255584582  82 RYRKTLIERTKYHLGYPYNLDFDYGALGQ-LQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWEIERNEYWGYITN 160
297852162  88 RYRKTLVERTKFHLGYPYNLDFDYGALGQ-LQHFSINNLGDPFIESNYGVHSRPFEVGVLDWFARLWEIERDDYWGYITN 166
302844899  88 NYMKKLAERTHHHMGYPYNLDFDYGLLEG-LTKYSINNLGDPFIESNYGVHSREFEVGVLNWFARLWEIDEEEYWGYITT 166
302810902  80 RYRKTLVERTKYHLGYPYNLDFDYGALSQ-LQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWELEKNEYWGYITN 158
302788929  80 RYRKTLVERTKYHLGYPYNLDFDYGALSQ-LQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWELEKNEYWGYITN 158
297599383     --------------------------------------------------------------------------------    
242055685 161 CGTEGNLHGLLVGREVFPDGVMYASADSHYSVFRAARMYRVRCVKVGTLVSGEMDCDDFEAKLMHNTNSPAIVNVNIGTT 240
15218445  173 CGTEGNLHGILVGREMFPDGILYASRESHYSVFKAARMYRMECEKVDTLMSGEIDCDDLRKKLLANKDKPAILNVNIGTT 252
224082428 163 CGTEGNLHGILVGREVFPDGVLYASRESHYSVFKAARMYRMDCEKVDCLISGEIDCADFKAKLLANKDKPAIINVNIGTT 242
224066727 153 CGTEGNLHGILVGREVFPDGILYASRESHYSVFKAARMYRMGCVKVDCLVSGEIDCADFKVKLLANKDKPAIINVNIGTT 232
225463912 172 CGTEGNLHGILVGREVLPDGILYASQETHYSVFKAARMYRMECVKVATSLSGEIDCADFKAKLLANKDKPAIINVNIGTT 251
242061884 185 CGTEGNLHGILVGREVFPDGILYASRESHYSVFKAARMYRMDCVKVDTLMSGEIDCADFHRKLLQNRDKPAIINVNIGTT 264
255584582 161 CGTEGNLHGILVGREVFPDGVLYASRESHYSVFKAARMYRMESVKIDCLVSGEIDCADFKVKLLANKDKPAIINVNIGTT 240
297852162 167 CGTEGNLHGILVGREMFPDGILYASRESHYSV--------------DTLISGEIDCDDFRKKLLANKDKPAILNVNIGTT 232
302844899 167 CGTEGNLHGILVGRENFPDGIMYASAESHYSVFKAARMYRMQAEKISTLESGEINYEELKTALIANQGKPAVLNLNIGTT 246
302810902 159 CGTEGNLHGLLVGREVFPDGILYASKDSHYSVFKAGRMYRMEVVKVDTLLSGEIDCADFQRRLLENQDKPAIVNVNIGTT 238
302788929 159 CGTEGNLHGLLVGREVFPDGILYASKDSHYSVFKAGRMYRMEVVKVDTLLSGEIDCADFQRRLLENQDKPAIVNVNIGTT 238
297599383     --------------------------------------------------------------------------------    
242055685 241 VKGAIDDLDKIISTLQKCGF-HDRFYIHCDGALAGLIIPFLKQ-APRVTFRKPgIGSVSVSGHKFLGCPVPCGVVITRRE 318
15218445  253 VKGAVDDLDLVIKTLEECGFsHDRFYIHCDGALFGLMMPFVKR-APKVTFNKP-IGSVSVSGHKFVGCPMPCGVQITRME 330
224082428 243 VKGAVDDLDLVIQTLEESGFsQDRFYIHCDGALFGLMMPFVKR-APKVTFKKP-IGSVSVSGHKFVGCPMPCGVQITRME 320
224066727 233 VKGAVDDLDLVIQTLEESGFsQDRFYIHCDGALFGLMMPFVKR-APKVTFKKP-IGSVSVSGHKFVGCPMPCGVQITRME 310
225463912 252 VKGAVDDLDLVIETLEECGFtHDRFYIHCDGALFGLMMPFVKR-APKVTFKKP-IGSVSVSGHKFVGCPMPCGVQITRME 329
242061884 265 VKGAVDDLDLVIKTLEENGF-KDRFYIHCDGALFGLMIPFVKK-APQVTFKKP-IGSVSVSGHKFVGCPMPCGVQITRLE 341
255584582 241 VKGAVDDLDLVIQTLEECGFtQNRFYIHCDGALFGLMMPFVKR-APKVSFKKP-IGSVSVSGHKFVGCPMPCGVQITRME 318
297852162 233 VKGAVDDLDLVIKTLEECGFsHDRFYIHCDGALFGLMMPFVKR-APKVTFNKP-IGSVSVSGHKFVGCPMPCGVQITRME 310
302844899 247 VKGAVDDVDRVLEVLKEAGYsEDQFFIHCDGALFGMMMPFLRRdAPMVTFRKP-IGSVSVSGHKFVGAPVPCGVVITRFK 325
302810902 239 VKGAVDDLDGVIRTLEDCGFsQDRFYIHCDGALFGLMMPFVKR-APKVSFKKP-IGSVSVSGHKFVGCPMPCGIQITRIE 316
302788929 239 VKGAVDDLDGVIKTLEDCGFsQDRFYIHCDGALFGLMMPFVKR-APKVSFKKP-IGSVSVSGHKFVGCPMPCGIQITRIE 316
297599383   1 -------------------------YIHCDGALFGLMIPFVKK-APKVSFKKP-IGSVSVSGHKFVGCPMPCGVQITRLE 53 
242055685 319 HAAVLSTDVDYISSRDATITGSRNGHAPLFLWCALNAKGRRGIRDDVHRCLRNARFLARRLRDAGVSAArLNPLSITVVL 398
15218445  331 HIKVLSSNVEYLASRDATIMGSRNGHAPLFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLREAGISAM-LNELSSTVVF 409
224082428 321 HIDVLSRNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLHDAGISAM-LNELSSTVVF 399
224066727 311 HINVLSSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAYYLKDRLRDAGISAM-LNELSSTVVF 389
225463912 330 HINALSRNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLRDAGISAM-LNELSSTVVF 408
242061884 342 HINALSSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYRGFQKEVQKCLRNAHYLKDRLKEAGVGAM-LNELSSTVVF 420
255584582 319 HINVLSKNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYKGFQKDVQKCLRNAHYLKGRLRDAGISAM-LNELSSTVVL 397
297852162 311 HIKVLSNNVEYLASRDATIMGSRNGHAPLFLWYTLNRKGYKGFQKEVQKCLRNAHYLKDRLCEAGISAM-LNELSSTVVF 389
302844899 326 HVMALSSDVEYLNSRDATIMGSRNGHAPIYLWYTLTRKGYEGMRRDVERCMRNAHVLKQMLESAGIRTM-LNELSNTVVF 404
302810902 317 HINTLSRNVEYLASRDATIMGSRNGHAPLFLWYTLNRKGYRGFKKEVEKCLANAHYLAGCLRESGFGAM-LNELSSTVVF 395
302788929 317 HINTLSRNVEYLASRDATIMGSRNGHAPLFLWYTLNRKGYRGFKKEVEKCLANAHYLAGCLRESGFGAM-LNELSSTVVF 395
297599383  54 HINRLSSNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYRGFQKEVQKCLRNAHYLKDRLKEAGIGAM-LNELSSTVVF 132
242055685 399 ERPRDEAFVRKWQLSCQGGVAHVVVMPNVGVDKIASFVEDLAAKRRIWYPhgEGLrVGPCVAKDIGQENCLCSgLHN 475
15218445  410 ERPKDEEFVRRWQLACQGDIAHVVVMPSVTIEKLDNFLKDLVKHRLIWYE--DGS-QPPCLASEVGTNNCICP-AHK 482
224082428 400 ERPLDEEFVRRWQLACQGNIAHVVVMPSVTIEKLDDFLNELVEKRSIWYR--DGGvQPPCIAADVGCENCACA-LHK 473
224066727 390 ERPIDEDFVRRWQLACQGNIAHVVVMPSVTIEKLDDFVNELVEKRSTWYQ--DEKvRPPCIAADIGSQNCSCD-LHK 463
225463912 409 ERPVDDEFVRRWQLACQGNIAHVVVMPNVTIEKLDYFLDELIEKRNTWFL--DKKvQPPCVAADIGSENCLCD-LHK 482
242061884 421 ERPKDEEFVRRWQLACEGNIAHVVVMPSVNIDKLDYFLNELVEKRATWYQ--DGIsQPPCIARDVGVENCLCG-LHK 494
255584582 398 ERPKDEEFVRRWQLACQGNIAHVVVMPSVTIEKLDNFLDELVKKRSTWYQ--DGQvQSPCIAADVGSENCACA-LHN 471
297852162 390 ERPKDEEFVRRWQLACQGDIAHVVVMPSVTIEKLDNFLKDLVKHRSVWYE--DGS-QPPCLASEVGTNNCICP-THK 462
302844899 405 ERPKEEAFVRKWQLACEGDIAHVVVMPNITVEKLEEFVADYVQSRARVAI--AAAkRVACEAKAAEED------LDA 473
302810902 396 ERPQDEAFVRKWQLACQGKIAHAVVMPSVTVDKLKVFLKELIESRSRLFP--DGKiVAPCVADELGAKNCACV-KHS 469
302788929 396 ERPQDEAFVRKWQLACQGKIAHAVVMPSVTVDKLKVFLKELIESRSRLFP--DGKiVAPCVAEELGAKNCACV-KHS 469
297599383 133 ERPKDEEFVRRWQLACEGNIAHVVVMPSVTIDKLDYFLNELTEKRATWYQ--DGScQPPCLAKDVGEENCLCS-IHK 206
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap