Conserved Protein Domain Family
PLN02259

?
PLN02259: PLN02259 
branched-chain-amino-acid aminotransferase 2
Statistics
?
PSSM-Id: 177901
View PSSM: PLN02259
Aligned: 3 rows
Threshold Bit Score: 779.288
Threshold Setting Gi: 15218409
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15218409    1 MIKTITSLRKTLVLPLHLHIRTLQTFAKYNAQAASALREERKKPLYQNGDDVYADLDWDNLGFGLNPADYMYVMKCSKDG 80 
79317492    1 MIKTITSLRKTLVLPLHLHIRTLQTFAKYNAQAASALREERKKPLYQNGDDVYADLDWDNLGFGLNPADYMYVMKCSKDG 80 
297843816   1 MIKAISSLRKTLVLPLHLHIRTLQTFAKYNAQAASALREERKTPLYQNGDDEYVDLDWDNLGFGLTPADYMYVMKCSKVG 80 
15218409   81 EFTQGELSPYGNIQLSPSAGVLNYGQAIYEGTKAYRKENGKLLLFRPDHNAIRMKLGAERMLMPSPSVDQFVNAVKQTAL 160
79317492   81 EFTQGELSPYGNIQLSPSAGVLNYGQAIYEGTKAYRKENGKLLLFRPDHNAIRMKLGAERMLMPSPSVDQFVNAVKQTAL 160
297843816  81 EFTQGELSPYGNIQLSPSAGVLNYGQAIYEGTKAYRKENGKLLLFRPDHNALRMKLGAERMLMPSPSVDQFVNAIKQTAL 160
15218409  161 ANKRWVPPAGKGTLYIRPLLMGSGPILGLGPAPEYTFIVYASPVGNYFKEGMAALNLYVEEEYVRAAPGGAGGVKSITNY 240
79317492  161 ANKRWVPPAGKGTLYIRPLLMGSGPILGLGPAPEYTFIVYASPVGNYFKEGMAALNLYVEEEYVRAAPGGAGGVKSITNY 240
297843816 161 ANKRWVPPSGKGTLYIRPLLMGSGPILGLGPAPEYTFIVYASPVGNYFKEGMAALNLYVEEEYVRAAPGGAGGVKSITNY 240
15218409  241 APVLKALSRAKSRGFSDVLYLDSVKKKYLEEASSCNVFVVKGRTISTPATNGTILEGITRKSVMEIASDQGYQVVEKAVH 320
79317492  241 APVLKALSRAKSRGFSDVLYLDSVKKKYLEEASSCNVFVVKGRTISTPATNGTILEGITRKSVMEIASDQGYQVVEKAVH 320
297843816 241 APVLKALSRAKSQGFSDVLYLDSVKKKYLEEASSCNVFVVKGRTISTPATNGTILEGITRKSVMEIASDQGYQVVEKAVH 320
15218409  321 VDEVMDADEVFCTGTAVVVAPVGTITYQEKRVEYKTGDESVCQKLRSVLVGIQTGLIEDNKGWVTDIN 388
79317492  321 VDEVMDADEVFCTGTAVVVAPVGTITYQEKRVEYKTGDESVCQKLRSVLVGIQTGLIEDNKGWVTDIN 388
297843816 321 VDEVMDADEVFCTGTAVVVAPVGTITYQDKRVEYKTRDESVCQKLRSVLVGIQTGLIEDNKGWVTNIN 388
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap