Conserved Protein Domain Family
PLN02257

?
PLN02257: PLN02257 
phosphoribosylamine--glycine ligase
Statistics
?
PSSM-Id: 177899
View PSSM: PLN02257
Aligned: 18 rows
Threshold Bit Score: 722.296
Threshold Setting Gi: 145352581
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
302785984   1 LVIGGGGREHALCYGLQRAASCDGVFCAPGNIGISIAGDATCIADLDVSDSVAVISFCKRWEVGLVVVGPEAPLVAGLVD 80 
115487740  86 LVIGGGGREHALCYALERSPSCDAVFCAPGNSGIAQSGDATCIPDLDISNSDAVISFCRNWGVGLVVVGPEAPLVAGLAN 165
242068061  92 LVIGGGGREHALCYALNRSPSCSAVLCAPGNAGIAQSGDATCIADLDISSSADVISFCRERGVGMVVVGPEAPLVAGLVN 171
242088645  90 LVIGGGGREHALCHALNHSPSCAAVLCAPGNAGIAQSGDATCISDLDISSSDDVISFCRNRGVGMVVVGPEAPLVAGLAN 169
159474088   7 LVVGSGGREHSLAWKLSQSPLCNHLFCAPGNPGTETEPKVTNV-AVNVTKHKDVVQFCKEKDVGLVVVGPEVPLVAGLAD 85 
145352581  50 LVVGGGGREHALCWRLASSASAGTLYCAPGNAGIARERGVETV-TLNESDHAAVVGFCRERSIGLVVVGPEAPLVDGLAD 128
168043807  26 LVIGGGGREHALCYALQRSPTCSEVFCAPGNAGINTSGDAICVGELDITYSSAVIEFCQKSGVGLVVVGPEAPLVAGLVD 105
168002972  26 LVIGGGGREHALCHALQRSPTCNEVFCAPGNAGIGKSGDAICVRELDIKDSEAVIEFCKKSGVGLVVVGLEAPLVAGLVD 105
255079148   4 LVIGSGGREHALCWRLKQSPTCGELFCTPGNAGIIVEDGVQVV-DVKESDHAAVIKFCKDNNVGLVVVGPEAPLVDGIAD 82 
302831065  34 LVIGSGGREHSLAWKLSQSPICNHLFCAPGNPGTETEPNVTNV-GIDVANHQKVVQFCRERDVRLVVVGPEVPLVAGLAD 112
302785984  81 DLVEAGIPAFGPSASAAALEGSKSFMKDFCDKYKIPTAKYRSFTDPSAAKHYISEEGVPIVVKADGLAAGKGVTVAMSLE 160
115487740 166 ELVKAGIPTFGPSSEAAALEGSKDFMKKLCDKYHIPTAKYQSFTDPSDAKKYVEEQGAPIVVKADGLAAGKGVVVAMTLE 245
242068061 172 DLVKVGIPTFGPSSEAAALEGSKDFMKKLCDKYNIPTAKYRTFMDAVEAKQYVKHEGAPIVVKADGLAAGKGVVVAMTLD 251
242088645 170 DLVKVGIPTFGPTSEAAALEGSKDFMKKLCDKYDIPTAKYRTFTDAVEAKKYVKNEGAPIVVKADGLAAGKGVVVAMTLD 249
159474088  86 DLQAAGVPTWGPSARAAALEGSKAFMKDVCRKYDIPTAAYEKFTDPARAKAFIKQLGAPIVVKASGLAAGKGVVVARTVE 165
145352581 129 ALAAAGVPVFGPSKSAARLEGSKAFMKDLCAKYKIPTAEYAKFTDAAKAKAYIESKGAPIVVKTDGLAAGKGVIVAMEIE 208
168043807 106 DLVEAGIPAFGPSASAAALEGSKDFMKRLCDKYEIPTAKYQSFTDAEKAKTYIKEQGAPIVVKADGLAAGKGVVVAMTLE 185
168002972 106 DLADVGILAFGPSAAAASLEGSKNFMKRLCDKYEIPTAKYQSFTDAAEAKKYIKEQGAPIVIKADGLAAGKGVVVAMTLE 185
255079148  83 ALIAADIPCFGPTKDAARLEGSKGFLKDLLKKYNIPTAKYERFTDPEAAKKYIQKEGAPIVVKTDGLAAGKGVIVAMDVQ 162
302831065 113 DMQAAGIPTWGPSARAAQLEGSKAFMKDICRKYDIPTAAYEKFTDPARAKSFIKHLGAPIVVKASGLAAGKGVVVARTVE 192
302785984 161 EAYEAVDTMLVQGALGSAGGKIVVEEFLDGEEASFFAIVDGHTALPLASAQDHKRVGDGDIGPNTGGMGAYSPAPMVDSR 240
115487740 246 KAFEAIDSMLVEGSFGSAGSRVIVEEYLEGEEVSFFALVDGETALPLESAQDHKRVGDGDVGPNTGGMGAYSPAPIVTEK 325
242068061 252 EAFEAIDSMLVEGSFGSAGSRVIIEEFLEGEEASFFALVDGENALPLESAQDHKRVGDGDVGPNTGGMGAYSPAPIVTDE 331
242088645 250 EALEAIDSMLVEGSFGSAGSRVIIEEFLEGEEASFFALVDGENALPLESAQDHKRVGDGDVGPNTGGMGAYSPAPIVTDE 329
159474088 166 EAYQAVDDMLVRKVFGGAGDELVIEEFLDGEEVSFFALVDGEAAVPLVSAQDHKAVGDGDTGPNTGGMGAYSPAPAMNDT 245
145352581 209 DALNAVDDMLSGAMFGSAGEEIVVEEFLDGEEASFFAVVGGGKAVALASAQDHKRVGDGDTGLNTGGMGAYSPAPVVTPE 288
168043807 186 EAYAAVDSMLVSSEFGSAGGLVLVEEFLDGEEVSFFAIVDGENAVPMASAQDHKRVGDGDTGPNTGGMGAYSPAPALSPE 265
168002972 186 EAYAAVDSMLVSSEFGSAGGLVLVEEFLDGEEVSFFALVDGENALPMASAQDHKRVGDGDTGPNTGGMGAYSPAPALTPE 265
255079148 163 TALDAVDDMMVNSAFGSAGAEIVVEDFLDGEEASFFAVVGGGKAIPLVGAQDHKRVGEGDTGLNTGGMGAYSPAPVLTPA 242
302831065 193 EAYQAVDDMLVHKVFGGAGDELVIEEFLDGEEVSFFALVDGEAAIPLVSAQDHKAVGDGDTGPNTGGMGAYSPAPVMNEA 272
302785984 241 LESLVMDTIILPTVKGMAEEGCKYVGILYAGLMI-DKKTGIPKLLEYNVRFGDPECQVLMMRFESDLAKLLLAACKGELK 319
115487740 326 LKCKVMESIIVPTVKGMATEGCKFVGVLYAGIMI-EKKSGLPKLIEYNVRFGDPECQVLMMRLQSDLAQVLLAACRGELG 404
242068061 332 LKRIVMESIIVPTVKGMAAEGCKFVGVLYAGLMI-EKKSGLPKLIEYNVRFGDPECQVLMMRLESDLAQVLLSACRGGLS 410
242088645 330 LKRIVMESIIIPTVKGMAAEGCKFVGVLYAGLMI-EKKSGLPKLIEYNVRFGDPECQVLMMRLESDLAQVLLSACQGELG 408
159474088 246 IHKQVMDEIIYRTARGMAAEGAPFRGTLFAGLMI---KDGKAKLLEHNVRFGDPECQGLMALCASDLTDAMLAATRGRLG 322
145352581 289 ITDVVMRDIIKPTVDGMAAEGCPFTGVIFAGLMI--SKDGTVKLLEHNIRFGDPECQVLMARLTSDLTALLLAAATGTLE 366
168043807 266 LERKVMETIIYPTVKGMRAEGCKYVGVLYAGVII-EKKNGSPKLLEYNVRFGDPECQVLMIRLQSDLVQVLLSACKGNLN 344
168002972 266 IEQKVMETIIYPTVKGMRAEGCKYLGVLYAGVII-EKKNGLPKLLEYNVRFGDPECQVLLIRLQSDLVQVLLAACKGGLN 344
255079148 243 IEAKVMNDIIQPTVDGMAAEGCPFTGVIFAGLMI---KGDDVKLLEHNVRFGDPECQCLMARMRSDLVDLLLKAAKGELD 319
302831065 273 IFKQVMDEIIYRTARGMAAEGAPFRGTLFAGLMIkDGKVGCAKLLEHNVRFGDPECQGLMARCDSDLTEALLRATQGKLD 352
302785984 320 DIEgLKWTKDPALVVVLASSGYPGNYKKGTLIKNLDEAEAA----VRGVKVFHAGTDVDSDGHIVAVGGRVLGVTALGKD 395
115487740 405 SVS-LTWSPELATVVVMASEGYPGVYKKGTVIKNIDEAEQV----SPAVKIFHAGTALDRDGNFVAAGGRVLGVTAKGKD 479
242068061 411 NVS-LTWSPEMAMVVVMASQGYPGSYKKGTVIKNLDKAEQV----SPFVKIFHAGTALDEDGNLVAVGGRVLGVTAKGKD 485
242088645 409 NVS-LTWSPEMAMVVVMASQGYPGSYKKGTVIKNVDKAEQV----SPAVKIFHAGTALDGDGNLVAVGGRVLGVTAKGKD 483
159474088 323 DVR-LDWRPEAALTVVLAARGYPGEYPKGSVIRGLEG--------VTGAKVFHAGTARNAAGEVVSAGGRVLNVTALGAD 393
145352581 367 NAE-VTWSDDSAVVVVMAAEGYPGSYAKGEKITNLDAAGAI-----DGVKVLHAGTASDADGDVVSSGGRVLGVTAYGSS 440
168043807 345 GVQ-LEWAEDPALVVVMASNGYPGKYVTGTRIKNLDVAEVV----APGVKVFHAGTTMNSENEIVAAGGRVLGVTAVGKD 419
168002972 345 GVQ-LEWTEEPALVIVMASNGYPGKYVTGTRIKNLDVAEVI----APGVKIFHAGTTMNAEHEIVATGGRVLGVAAVGKD 419
255079148 320 KVGeLQWSEDMAINVVVAADGYPGSYAKGEMIGGLDAANAM-----DGVKVFHAGTAMK-DGKVTSAGGRVLGVTATGKN 393
302831065 353 DVN-LMWKPEAALTVVMAANGYPGKHLKGSVIRGLDRVTTAkvapAAAVQVFHAGTARNTAGEVVSNGGRVLNVTALGKD 431
302785984 396 IAEAQNRAYQAVDVVSWPDGFCRRDIGWRAVARLAEARHR 435
115487740 480 IEEARAKAYDALDVVDWPEGFFRHDIGWRAQKYRRMVAH- 518
242068061 486 IEEARARAYDAVDAVDWPEGFFRRDIGWRALRHKQVANCL 525
242088645 484 IEEARARAYDAVDAVQWPEGFFRRDIGWRALKQKQVAN-- 521
159474088 394 VAEAQAKAYAAVKQIQWADAYYRSDIGWRAVERLRAGKH- 432
145352581 441 ITEAAERAYEAVDVIEWPGGFTRRDIGWRAIAREKAR--- 477
168043807 420 IAEAQSKAYSAVDQIDWPEGFCRRDIGWRAVSRLQSVNLS 459
168002972 420 IAEAQSKAYKAVHQIDWPEGFFRNDIGWRAVSRLQGAHSS 459
255079148 394 ITEAAKKSYAAVDVIEWPGGFVRRDIGHRAIARENK---- 429
302831065 432 VAEAQARAYEAVKQIEWADAYYRSDIGWRAVARLKAPAKH 471
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap