Conserved Protein Domain Family
PLN02253

?
PLN02253: PLN02253 
xanthoxin dehydrogenase
Statistics
?
PSSM-Id: 177895
View PSSM: PLN02253
Aligned: 8 rows
Threshold Bit Score: 489.719
Threshold Setting Gi: 242037663
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15218213    3 TNTESSSYSSLPSQRLLGKVALITGGATGIGESIVRLFHKHGAKVCIVDLQDDLGGEVCKSLlrgESKETAFFIHGDVRV 82 
115456131   1 MSAAAAAAASSPAPRLESKVALVTGGASGIGEAIVRLFREHGAKVCIADIQDEAGQKLRDSL---GGDQDVLFVHCDVSV 77 
224053312   1 MATASSTDSSLSPLRLLGKVALVTGGATGIGESIARLFCRHGAKVCIADLQDNLGQNVCESL---GGEPKTCYIHCDVTI 77 
225449868   1 MAATSIDNSPLPSQRLLGKVALVTGGATGIGESIVRLFLKQGAKVCIVDVQDDLGQKLCDTL---GGDPNVSFFHCDVTI 77 
242037663   1 MAAAGSSPSSSSSKRLEGKVALVTGGATGIGEAIVRLFTEHGAKVCIADIQDEAGQQLRDALg--GDAQGVMFVHCDVTS 78 
255544059   1 MATTSSVGSTLYCQRLLGKVALVTGGSTGIGESIVRLFHKHGAKVCLVDLDDNLGQNVCKSL---GGEPNICYFHCDVTV 77 
255572807   1 MATTSSVASTLSCQRLLGKVALVTGGSTGIGESIVRLFHKHGAKVCLVDLEDNLGQNVCESL---GGEPNICYFHCDVTV 77 
297852988   3 TNTPSSSSALPPCDRLLGKVALITGGATGIGESIVRLFHKHGANVCIVDLQDDLGNEVCKSLlsgETKETACFIHGDVRV 82 
15218213   83 EDDISNAVDFAVKNFGTLDILINNAGLCGAPCPDIRNYSLSEFEMTFDVNVKGAFLSMKHAARVMIPEKKGSIVSLCSVG 162
115456131  78 EEDVARAVDATAEKFGTLDIMVNNAGFTGQKITDIRNIDFSEVRKVIDINLVGVFHGMKHAARIMIPNKKGSIISLGSVS 157
224053312  78 EDDVRQAVDFTVDKFGTLDIMVNNAGLGGPPCPDIRKVALSDFEKVFDVNVKGVFLGMKHAARIMIPLNKGSIVSLCSVA 157
225449868  78 EDDVCHAVDFTVTKFGTLDIMVNNAGMAGPPCSDIRNVEVSMFEKVFDVNVKGVFLGMKHAARIMIPLKKGTIISLCSVS 157
242037663  79 EEDVSRAVDAAAERFGALDVMVNNAGVTGAKVTDIRAVDFAEVRRVLDINVHGVFLGMKHAARVMIPQKRGSIVSLASVA 158
255544059  78 EDEVQRAVDFTVDKFGTLDIMVNNAGLSGPPCSDIRCTELSDFQKVFDVNTKGTFIGMKHAARVMIPLNRGSIISLCSVA 157
255572807  78 EDEVQRAVEFTVDKFGTLDIMVNNAGLSGPPCPDIRYTELSDFQKVFDVNVKGTFIGMKHAARIMIPLNKGSIISLCSVA 157
297852988  83 EDDISNAVDFAVKKFGTLDILINNAGLCGAPCPDIRNNSLSEFEKIFDVNVKGAFLSMKHAARVMIPEKKGSIVSLCSVG 162
15218213  163 GVVGGVGPHSYVGSKHAVLGLTRSVAAELGQHGIRVNCVSPYAVATKLALAHLPEEERTEDAFVGFRNFAAANANLKGVE 242
115456131 158 SVIGGLGPHSYTATKHAVVGLTKNVAGELGKHGIRVNCVSPYAVPTALSMPYLPQGERKDDALKDFFAFVGGEANLKGVD 237
224053312 158 SAIGGIGPHAYTGSKHAVLGLTRSVAAELGKHGIRVNCVSPYGVATSLAVAHLPEDERTEDALIGFRSFIGRNANLQGVE 237
225449868 158 SAIAGVGPHAYTGSKCAVAGLTQSVAAEMGGHGIRVNCISPYAIATGLALAHLPEDERTEDAMAGFRAFVGKNANLQGVE 237
242037663 159 SAIGGLGPHAYTASKHAVVGLTKSVAAELGRHGVRVNCVSPYAVPTALSMPHLPQGARADDALTDFLAFVGGEANLKGVD 238
255544059 158 STIGGLGPHAYTGSKHAVLGLTRNVAAELGKHGIRVNCVSPYAVPTNLALAHLPEDERTEDAMAGFKAFARKNANMQGIE 237
255572807 158 STIGGLGPHGYTGSKHAVLGLTRNVAAELGKHGIRVNCVSPYAVPTNLALAHLHEDERTEDAMAGFKAFARKNANLQGVE 237
297852988 163 GVMGGIGPHAYVGSKHAVLGLTRSVAAELGQHGIRVNCVSPYAVATKLALAHLPEEERTEDAFVGFRNFAAANANLKGVE 242
15218213  243 LTVDDVANAVLFLASDDSRYISGDNLMIDGGFTCTNHSFKVFR 285
115456131 238 LLPKDVAQAVLYLASDEARYISALNLMVDGGFTSVNHNLRAFE 280
224053312 238 LTVDDVANAVLFLASDEARYISGDNLMLDGGFTCTNHSLRVFR 280
225449868 238 LTVDDVAHAAVFLASDEARYISGLNLMLDGGFSCTNHSLRVFR 280
242037663 239 AMPKDVAQAVLYLASDEARYVSALNLMVDGGFTAVNHNLRPFD 281
255544059 238 LTADDVANSVLFLASEESRYISGANLMIDGGFTTSNHSLRVFR 280
255572807 238 LTADDVANSVLFLASEESRYISGENLMIDGGFTNSNHSLRVFR 280
297852988 243 LTVDDVANAVLFLASDESRYISGDNLMIDGGFTCTNHSFKVFR 285
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap