Conserved Protein Domain Family
PLN02249

?
PLN02249: PLN02249 
indole-3-acetic acid-amido synthetase
Statistics
?
PSSM-Id: 177891
View PSSM: PLN02249
Aligned: 4 rows
Threshold Bit Score: 1276.91
Threshold Setting Gi: 297802218
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15235538    1 MAVDSPLQSRMVSATTSEKDVKALKFIEEMTRNPDSVQEKVLGEILTRNSNTEYLKRFDLDGVVDRKTFKSKVPVVTYED 80 
15218026    1 MAVDSLLQSGMASPTTSETEVKALKFIEEITRNPDSVQEKVLGEILSRNSNTEYLKRFDLNGAVDRKSFKSKVPVVIYED 80 
297802218   1 MAVDSPLQSRMVSPTTSEKDVKALKFIEEMTRNPDSVQEKVLGEILSRNSNTEYLKRFDINGAIDRNTFKNKVPVVTYED 80 
297837595   1 MAVDSPLQSRIASPTTSEKDMKALMFIEEMTRNPDSVQEKVLGEILSRNSNTEYLKRFDLNGAVDRKTFKSKVPVVMYED 80 
15235538   81 LKPEIQRISNGDCSPILSSHPITEFLTSSGTSAGERKLMPTIEEDLDRRQLLYSLLMPVMNLYVPGLDKGKGLYFLFVKS 160
15218026   81 LKTDIQRISNGDRSPILSSHPITEFLTSSGTSAGERKLMPTIEEDINRRQLLGNLLMPVMNLYVPGLDKGKGLYFLFVKS 160
297802218  81 LKPEIQRISNGDRSPILSSHPITEFLTSSGTSAGERKLMPTIEEDLDRRQLLYSLLMPVMNLYVPGLDKGKGLYFLFVKS 160
297837595  81 LKTEIQRISNGDRSPILSSHPINEFLTSSGTSSGERKLMPTIEEDIHRRQLLGSLLMPVMNLYLPGLDKGKGLYFLFVKS 160
15235538  161 ESKTSGGLPARPVLTSYYKSDHFKRRPYDpyNVYTSPNEAILCSDSSQSMYAQMLCGLLMRHEVLRLGAVFASGLLRAIS 240
15218026  161 ESTTSGGLPARPALTSYYKSDYFRTSDSD--SVYTSPKEAILCCDSSQSMYTQMLCGLLMRHEVNRLGAVFPSGLLRAIS 238
297802218 161 ESKTSGGLPARPVLTSYYKSDHFRRRPYDpyNVYTSPNEAILCSDSSQSMYAQMLCGLLMRHEVLRLGAVFASGLLRAIS 240
297837595 161 ESKTSGGLPARPALTSYYKSDHFKTSDLQ--NDYTSPREAILCSDSSQSMYAQMLCGLLMRHEVLRLGAVFPSGLLRAIS 238
15235538  241 FLQNNWKELARDISTGTLSSRIFDPAIKNRMSKILTKPDQELAEFLVGVCSQENWEGIITKIWPNTKYLDVIVTGAMAQY 320
15218026  239 FLQNNWKELSQDISTGTLSSKIFDHAIKTRMSNILNKPDQELAEFLIGVCSQENWEGIITKIWPNTKYLDVIVTGAMAEY 318
297802218 241 FLQNNWKELARDISTGTLSSRIFDPTIKNRMSKILIKPDQELAEFLIGVCSQENWEGIITKIWPNTKYLDVIVTGAMAQY 320
297837595 239 FLQNNWKELAQDISTGILSSKIFDPAVNNRMSKILNKPDEELAEFLIGVCSQENWEGIITKIWPNTKYLDVIITGAMAQY 318
15235538  321 IPTLEYYSGGLPMACTMYASSESYFGINLKPMCKPSEVSYTIMPNMAYFEFLPHNHDGDGAaeasLDETSLVELANVEVG 400
15218026  319 IPMLEYYSGGLPMASMIYASSESYFGINLNPMCKPSEVSYTIFPNMAYFEFLPHNHDGDGG----VEATSLVELADVEVG 394
297802218 321 IPTLEYYSGGLPMACTMYASSESYFGINLKPMCKPSEVSYTIMPNMAYFEFLPHNHDGDGAteasLDETSLVELADVEVG 400
297837595 319 IPMLEYYSGGLPIASTIYASSESYFGINLNPMCKPSEVSYTIMPNMAYFEFLPHNHDGDGA----LDETSLVELADVEVG 394
15235538  401 KEYELVITTYAGLYRYRVGDILRVTGFHNSAPQFKFIRRKNVLLSVESDKTDEAELQKAVENASRLFAEQGTRVIEYTSY 480
15218026  395 KEYELVITTYAGLYRYRVGDILRVTGFHNSAPQFKFIRRENVLLSIESDKTDEADLQKAVENASRLLAEQGTRVIEYTSY 474
297802218 401 KEYELVITTYAGLYRYRVGDILRVTGFHNSAPQFKFIRRKNVLLSIESDKTDEAELQKAVENASRLFAEQGTRVIEYTSY 480
297837595 395 KEYELVITTYAGLYRYRVGDILCVTGFHNSAPQFKFIRRKNVLLSIESDKTDEADLQKAVDNASRLLAEQGTSVIEYTSY 474
15235538  481 AETKTIPGHYVIYWELLGRDQSNALMSEEVMAKCCLEMEESLNSVYRQSRVADKSIGPLEIRVVRNGTFEELMDYAISRG 560
15218026  475 ADTKTIPGHYVIYWELLSRDQSNALPSDEVMAKCCLEMEESLNAVYRQSRVSDKSIGPLEIRVVQNGTFEELMDFSISRG 554
297802218 481 AETKTIPGHYVIYWELLGRDQSNALPSEEVMAKCCLEMEESLNSVYRQSRVADKSIGPLEIRLVQNGTFEELMDYAISRG 560
297837595 475 AETKTIPGHYVIYWELLGRDQSNALPSDEVMAKCCLEMEESLNSVYRQSRVSDKSIGPLEIRVVQNGTFDELMDYAISRG 554
15235538  561 ASINQYKVPRCVSFTPIMELLDSRVVSAHFSPSLPHWSPERRR 603
15218026  555 SSINQYKVPRCVSLTPIMKLLDSRVVSAHFSPSLPHWSPERRH 597
297802218 561 ASINQYKVPRCVSFTPIMELLDSRVVSAHFSPSLPHWSPERRR 603
297837595 555 SSINQYKVPRCVSLTPILELLDSRVVSAHFSTSLPHWSPERRH 597
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap