Conserved Protein Domain Family
PLN02247

?
PLN02247: PLN02247 
indole-3-acetic acid-amido synthetase
Statistics
?
PSSM-Id: 165890
View PSSM: PLN02247
Aligned: 6 rows
Threshold Bit Score: 1232.51
Threshold Setting Gi: 297845760
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15217844    1 MIPSYDPNDTEAGLKLLEDLTTNAEAIQQQVLHQILSQNSGTQYLRAFLDGEADKnqQSFKNKVPVVNYDDVKPFIQRIA 80 
225425302   1 MLLSCDPHDNEAGLMLLEDLTTNANQVQLEVLEEILTQNANTEYLRGYLDGHSDK--GLFKKKVPIVNYEDIKPHIERIA 78 
224072455   1 MLPIFDPNDNEAGLKLLEDLTNNACQIQRQVLEYILTTNLHTGYLKSFLNGDSSK--ENFKNKVPIVNYEDIKPCIERIA 78 
224057862   1 MLPVFDPNDNEAGLKLLEDLTNNACQIQQQVLEEILATNLHTEYLKSFLNGDSGK--ENFKNKVPIVNYEDIKPCIERIA 78 
255543248   1 MFPSYDPNDNEAGLKLLEELTTNACQIQDNVLQLILTNNAQTKYLSSFLDGLSDK--LDFKEKVPVVNYEDIRPCIECIA 78 
297845760   1 MIPSYDPNDTEAGLKLLDDLTTNAETIQQQVLHQILSQNSGTQYLRAFLDGESDKnqQSFKNKVPVVNYDDIKPFIQRIA 80 
15217844   81 DGESSDIVSAQPITELLTSSGTSAGKPKLMPSTAEELERKTFFYSMLVPIMNKYVDGLDEGKGMYLLFIKPEIKTPSGLM 160
225425302  79 NGEPSRIISAQPITELLTSSGTSGGQPKLMPSTAEDLDRKTFFYNLLIPVMNKYVDGLDQGKGMYLLFIKPEISTPSGLM 158
224072455  79 NGEPSSIISAQPITELLTSSGTSGGQPKMMPSTAEELERKTFFYNLLMPIMNKYVDGLDQGKGMYLLFTKPEISTPSGLM 158
224057862  79 NGEPSSIISTQPITELLTSSGTSGGQPKIMPSTAEELERKTFFYNLLVPVMNKYVDGLDQGKAMYLLFIKPEISTPSGLM 158
255543248  79 NGGSSSIISAQPITELLTSSGTSGGQPKMMPSTAEELDRKTFFYNLLVPVMNKYIDGLDQGKGMYLLFIKPEISTPSGLM 158
297845760  81 DGESYDIVSAQPITELLTSSGTSAGKPKLMPSTAEELDRKTFFYSMLVPIMNKYVNGLDEGKGMYLLFIKPEIKTPSGLM 160
15217844  161 ARPVLTSYYKSQHFRNRPFNKYNVYTSPDQTILCQDSKQSMYCQLLCGLVQRSHVLRVGAVFASAFLRAVKFLEDHYKEL 240
225425302 159 ARPVLTSYYKSSNFRNRPFNPFNVYTSPDETILCLDSKQSMYCQLLCGLVQRDEVLRVGAVFASAFLRAIKFLEDHWREL 238
224072455 159 ARPVLTSYYKSSNFRNRAFNRYNVYTSPDETILCPDSKQSMYCQLLCGLVQREEVLRVGAVFASAFLRAIKFLEEYQKEL 238
224057862 159 ARPVLTSYYKSNNFRNRAFNRYNVYTSPDETILCSDSKQSMYCQLLCGLVQRDEVLRVGAIFASAFLRAIKFLEEYLKEL 238
255543248 159 ARPVLTSYYKSSNFRNRPFNRYNVYTSPDETILCPDSKQSMYCQLLCGLVQRDEVLRVGAIFASAFLRAIKFLEDYWQEL 238
297845760 161 ARPVLTSYYKSQHFRNRPFNKYNVYTSPDQTILCQDSKQSMYCQLLCGLVQRSHVLRVGAVFASAFLRAVKFLEDHYKEL 240
15217844  241 CADIRTGTVTSWITDSSCRDSVLSILNGPNQELADEIESECAEKSWEGILRRIWPKAKYVEVIVTGSMAQYIPTLEFYSG 320
225425302 239 CSNIRTGCVSDWITDPSCRNAVSSFLSKPQPDLADFIEFECNGESWEGIIKRLWPRTKYIEVIVTGSMAQYIPTLEFYSG 318
224072455 239 CSNIRTGRLSDWITDPNCRNAVSSFLSKPNSELADLIEVECSGKSCEGIIKKLWPRTKYIEVIVTGSMAQYIPTLEFYSG 318
224057862 239 CSNIRTGSVSDWITDPNCRNAVLSILSKPNSELADLIEDECSGKSWEGIIKKLWPRTKYIEVIVTGSMAQYIPTLEFYSG 318
255543248 239 CSNIRTGCISDWIDDPSCRNAVSSILKKPNSELADLIERKCSNKSWEGIIKKLWPRTKFIEVIVTGSMAQYIPTLEFYSG 318
297845760 241 CADIRTGTVTSWITNSSCRDSVLSILNGPNQELADEIESECAEKSWEGILRRIWPKAKYVEVIVTGSMAQYIPTLEFYSG 320
15217844  321 GLPLVSTMYASSECYFGINLNPLCDPADVSYTLLPNMAYFEFLPVDDKSHEEIHFATHSNTDDDDDALKEDL-IVNLVNV 399
225425302 319 GLPLVSTMYASSECYYGINLKPLSKPSDVSYTLLPNMAYFEFLPVQKNNGEVTQQVQCNGGCIKKEGERVEIeVVGLVDV 398
224072455 319 GLPLVSTMYGSSECYLGINFKPLSNPSDVSYTLIPNMAYFEFLPVDKDNKKVI-------------QAEKDVeAVDLEDV 385
224057862 319 GLPLVSTMYGSSECYLGINFKPLSNPYDVSYTLLPNMAYFEFLPVDNNHKEVVPDVQCNGVSVTDRNGKEKVeAVDLVDV 398
255543248 319 GLPLVSTMYASSECYFGINFKPLSAPSDVSYTLLPNMAYFEFLPVERGYGA---------------KQKKKMeTVDLVDV 383
297845760 321 GLPLVSTMYASSECYFGINLNPLCDPADVSYTLLPNMAYFEFLPVDDKSHEEIHFASHSNTDDDDDALKEDL-IVDLVNV 399
15217844  400 EVGQYYEIVITTFTGLYRYRVGDILKVTGFHNKAPQFRFVQRRNVVLSIDTDKTSEEDLLNAVTQAKLnhLQHPSSLLLT 479
225425302 399 KVGHYYELVVTTFTGLYRYRTGDILMVTGFYNNAPQFRFVQRRNVVLSIDTDKTNEEDLLKAVTQAKL--LLEPYGFLLT 476
224072455 386 KLGHYYELVVTTFTGLYRYRVGDILMVTGFYNNAPQFRFVHRRNVVLSIDTDKTNEEDLLKAVTQAKV--LLEPLGFLLT 463
224057862 399 KLGHYYELIVTTFTGLYRYRVGDILMVTGFYNNAPQFRFVHRRNVVLSIDTDKTNEEDLLKAVTQAKV--LLEPLGFLLT 476
255543248 384 KVGHYYELVVTTFTGLYRYRVGDILMVTGFYNNAPQFRFVHRRNVVLSIDTDKTNEEDLLKAVTQAKR--LLEPLGFLMT 461
297845760 400 KVGQYYEIVITTFTGLYRYRVGDILKVTGFHNKAPQFRFVQRRNVVLSIDTDKTSEEDLLNAVTQAKLnhLQHPSSLLLM 479
15217844  480 EYTSYADTSSIPGHYVLFWELKPRHSNDPPKLDDKTMEDCCSEVEDCLDYVYRRCRNRDKSIGPLEIRVVSLGTFDSLMD 559
225425302 477 EYTSYADTSSIPGHYVLFWELKTRGNNDLSEPDHTIMEQCCSTVEESLDSVYRRCRRRDNSIGPLEIRIVKPGTFDALMD 556
224072455 464 EYTSFADTSSIPGHYVLFWELKTQGTNDLPELDPITMEKCCSTVEESLDSIYRRCRKKDKSIGPLEIRVVTHGTFDALMD 543
224057862 477 EYTSFADTASIPGHYVLFWELKMRGTNDLPELDPVIMEQCCSIVEESLDSVYRRCRKKDKSIGPLEVRVVTHGTFDALMD 556
255543248 462 EYTSFADTSSIPGHYVLFWELKTRGENVPEELDPIIMEQCCLTVEESLDSVYRRCRKKDKSIGALEIRVVKHGTFDALMD 541
297845760 480 EYTSYADTSSIPGHYVLFWELKPRHSNDPPKLDDKTMDDCCSEVEDCLDYVYRRCRNRDKSIGPLEIRVVSLGTFDSLMD 559
15217844  560 FCVSQGSSLNQYKTPRCVKSGGALEILDSRVIGRFFSKRVPQWEPLGLDS 609
225425302 557 FCVSQGSSVNQYKTPRCIKSKEAIKILDSRVVGKVFSKKVPFWEPFKMET 606
224072455 544 FCVSQGSSVNQYKTTRCIKSEEAFKILHSRVVGRFFSKKTPFWE------ 587
224057862 557 FCVSQGSSVNQYKTPRCIKSEEALKILDSRVVGRFSSNKTPFWEPFRIET 606
255543248 542 FCLSQGSSVNQYKTPRCIKSEAALKILDSRVIGKFFSKRAPFWEPFRME- 590
297845760 560 FCVSQGSSLNQYKTPRCVKSGGALEILDSRVIGRFFSKRVPQWEPLGLDS 609
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap