Conserved Protein Domain Family
PLN02243

?
PLN02243: PLN02243 
S-adenosylmethionine synthase
Statistics
?
PSSM-Id: 177886
View PSSM: PLN02243
Aligned: 47 rows
Threshold Bit Score: 638.405
Threshold Setting Gi: 223998420
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
255089469   6 GSTFFFTSESVNEGHPDKLADQISDAVLDACLAEDPDSKVACETATKTGMVMVFGEITTKAKVDYEAVVRKVCNDVGFTS 85 
159477124   4 LESFLYTSESVNEGHPDKICDQVSDAVLDACLEQDPDSKVACETCCKTGMVMVFGEITTKAKVDYEAIVRKVCKEIGFTS 83 
145353876   1 -MGFLFTSESVNEGHPDKLADQISDGILDACLAQDPDSKVACETATKTNMVMVFGEITTKAKVDYEAVVRQVCRDVGFIS 79 
145353951   1 -MGFLFTSESVNEGHPDKLADQISDGILDACLAQDPDSKVACETATKTNMVMVFGEITTKAKVDYEAVVRQVCRDVGFIS 79 
219114353   3 DTTFLFTSESVNEGHPDKFCDQVSDAVLDACIAGDEMSRVACETCCKTGMVMIFGEITTAATVNYEQVIRDAIKDIGYDD 82 
225441191   1 MDTFLFTSESVNEGHPDKLCDQVSDAILDACLEQDPESKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFVS 80 
225441193   1 MDTFLFTSESVNEGHPDKLCDQVSDAILDACLEQDPESKVACETCSKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFVS 80 
224068797   1 MDTFLFTSESVNEGHPDKLCDQVSDAILDACLAQDPESKVACETCSKTNMVMVFGEITTKANVDYEKIVRDTCRGIGFTS 80 
255556894   1 METFLFTSESVNEGHPDKLCDQVSDAILDACLEQDPESKVACETCTKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTS 80 
255565429   1 MDTFLFTSESVNEGHPDKLCDQVSDAILDACLEQDPESKVACETCTKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFVS 80 
255089469  86 EAVGLDGNNCRVLVELHAQSPEIGQGVHGMGTKALEEIGAGDQGIMFGYATDESEayaeykgKFMPMTLMLANAIGYRLT 165
159477124  84 EDVGLDADKCKVLVHIEEQSPDIGQGVHGMGTKALEEIGAGDQGHMFGYATDETP-------ELMPLTHVLATQLGYKLT 156
145353876  80 DETGLDGNKCRVLVELHDQSPDIGQGVHGMGTKSDEDIGAGDQGHMFGYATDETP-------ELMPLTHVLATKLGHRLT 152
145353951  80 DETGLDGNKCRVLVELHDQSPDIGQGVHGMGTKSDEDIGAGDQGHMFGYATDETP-------ELMPLTHVLATKLGHRLT 152
219114353  83 PAKGFDYKTCNVIVAIEEQSPDIAQSVD---AVKVEDIGAGDQGIMFGYATDETE-------SLMPLTHMLATQIGSKLT 152
225441191  81 ADVGLDADNCKVLVNIEQQSPDIAQGVHGHLSKKPEEIGAGDQGHMFGYATDETP-------ELMPLTHVLATKLGAKLT 153
225441193  81 ADVGLDADNCKVLVNIEQQSPDIAQGVHGHLSKKPEEIGAGDQGHMFGYATDETP-------ELMPLTHVLATKLGAKLT 153
224068797  81 ADVGLDADNCKVLVNIEQQSPDIAQGVHGHLTKKPEEIGAGDQGHMFGYATDETP-------ELMPLTHVLATKLGAKLT 153
255556894  81 PDVGLDADNCKVLVNIEQQSPDIAQGVHGHLSKKPEEIGAGDQGHMFGYATDETP-------ELMPLTHVLATKLGAKLT 153
255565429  81 ADVGLDADKCKVLVNIEQQSPDIAQGVHGHLTKKPEEIGAGDQGHMFGYATDETR-------ELMPLTHVLATKLGAKLT 153
255089469 166 EVRKNGTCPWVRPDGKTQVTIEYKNEGGAMRPQRVHTVLISTQHDETVTNEKIAEDLMTEVIKKVIPADLLDANTIFHLN 245
159477124 157 EVRKNGVCPWLRPDGKTQVTVEYKREGGAMIPQRVHTILISTQHNPDVTNEKIREDLMEHVIKPVVPAKYLDDKTIFHLN 236
145353876 153 VVRKDGTCPWVLPDGKTQVTIEYENEGGAMVPKRVHTILISTQHIEGVTNEKIAEDLMNEVIKKVVPEKYLDADTIFHLN 232
145353951 153 VVRKDGTCPWVLPDGKTQVTIEYENEGGAMVPKRVHTILISTQHIEGVTNEKIAEDLMNEVIKKVVPEKYLDADTIFHLN 232
219114353 153 EVRKNGTCEWVRPDGKTQVTCEYKLVNGVPVPQRVHTIVISTQHAEDVTNEQIAADLMEHVIKPVVPEKYLDEKTIYHLN 232
225441191 154 EVRKNKTCPWLRPDGKTQVTVEYRNEGGAMVPIRVHTVLISTQHDETVTNDQIAKELREHVIKPVIPSKFMDDKTIFHLN 233
225441193 154 EVRKNKTCPWLRPDGKTQVTVEYRNEGGAMVPIRVHTVLISTQHDETVTNDQIAKELREHVIKPVIPSKFMDDKTIFHLN 233
224068797 154 EVRKNKTCPWLRPDGKTQVTVEYKNEGGAMVPIRVHTILISTQHDENVTNEQIAADLKEHVIKPVIPVQYLDDKTIFHLN 233
255556894 154 EVRKNKTCPWLRPDGKTQVTVEYKNDGGAMVPVRVHTVLISTQHDETVTNEQIAADLKEHVIKPVIPAQYLDDKTIFHLN 233
255565429 154 EVRKNKTCPWLRPDGKTQVTVEYRNEGGVMIPLRVHTVLISTQHDETVNNEQIAEDLKEHVIKPVIPSQYLDDNTIFHLN 233
255089469 246 PSGRFTIGGPDGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSAAYISRQAAKSVVAAGLAKRCIVQLSYAIGVP 325
159477124 237 PSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIARQAAKSVVASGLAKRCLVQVSYSIAVA 316
145353876 233 PSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYISRQAAKSVVAAGLARRCLFQISYAIGVA 312
145353951 233 PSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYISRQAAKSVVAAGLARRCLFQISYAIGVA 312
219114353 233 PSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDTTKVDRSAAYAARWVAKSLVAAKLCKRALVQLSYAIGVP 312
225441191 234 PSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSVVASGLARRCLVQVSYAIGVP 313
225441193 234 PSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSVVASGLARRCLVQVSYAIGVP 313
224068797 234 PSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSVVASGLARRCIVQVSYAIGVP 313
255556894 234 PSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSVVASGLARRCIVQVSYAIGVP 313
255565429 234 PSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQCAKSILASGLARRCIVQVSYAIGVP 313
255089469 326 EPLSVFVDTYGTGT--IPDEEILAKVKAAMDFRPGPVGRDLDLKRstsktsGKNNRYQQTAAYGHFGRD-DYDvFTWEKP 402
159477124 317 EPLSVFVDTYGTGT--MPDAEILKLIRKHFDFRPGLIGKNLDLKR------GGNKRYQKTAAYGHFGRD-DPD-FTWETV 386
145353876 313 EPLSVHVDTYGTGK--IPDSEILAKVKAAFDFRPGMMGKALDLKR------GGNKRYQTTAAYGHFGRDeDLDiFTWEKV 384
145353951 313 EPLSVHVDTYGTGK--IPDSEILAKVKAAFDFRPGMMGKALDLKR------GGNKRYQTTAAYGHFGRDeDLDiFTWEKV 384
219114353 313 YPLSVFVDSYGTVKegMTDADLTEVINKNFDLRPGCIIRDLNLRR---------AVMRKTAAYGHFGRE-DPD-FTWEQV 381
225441191 314 EPLSVFVDTYKTGK--IPDKDILDLIKENFDFRPGMIAINLDLKR------GGNFRFQKTAAYGHFGRD-DPD-FTWETV 383
225441193 314 EPLSVFVDTYKTGK--IPDKDILDLIKENFDFRPGMIAINLDLKR------GGNFRFQKTAAYGHFGRD-DPD-FTWETV 383
224068797 314 EPLSVFVDTYKTGK--IPDRDILELIKENFDFRPGMIAINLDLMR------GGNSRYQKTAAYGHFGRD-DPD-FTWETV 383
255556894 314 EPLSVFVDTYKTGK--IPDRDILALIKESFDFRPGMMAINLDLKR------GGNFRFQKTAAYGHFGRD-DPD-FTWETV 383
255565429 314 EPLSVFVDTYRTGK--IPDKDILALVKEKFDFRPGMIANNLDLKR------GGNFRYQKTAAYGHFGRD-DPD-FTWEIV 383
255089469 403 VAL 405
159477124 387 KKL 389
145353876 385 VPL 387
145353951 385 VPL 387
219114353 382 KEL 384
225441191 384 KLL 386
225441193 384 KLL 386
224068797 384 KLL 386
255556894 384 KIL 386
255565429 384 KPL 386
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap