Conserved Protein Domain Family
PLN02240

?
PLN02240: PLN02240 
UDP-glucose 4-epimerase
Statistics
?
PSSM-Id: 177883
View PSSM: PLN02240
Aligned: 38 rows
Threshold Bit Score: 598.871
Threshold Setting Gi: 224000954
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
219118249   1 MSDTRATILVTGGCGYIGTHTIVCLL-------QKD-YDVVVADNLSNSSIVSLDRVAEI-VGlSehdRASRLVFHQVDI 71 
159481273   1 MSLAGKNIFVTGGLGFIGSHTVLVLL-------EHG-ATVHLIDNMANSFERVFEHMKKL-AG-D---KADKMKFTKCDI 67 
145349820   1 --MDDVRVLVTGGAGYIGTHACVQLL-------LAG-ASVVAIDNFDNSCAEAVERVRAI-VGeR---RAARLTFRECDC 66 
115480267  21 RKGAGASVLVTGGAGYIGTHTVLRLL-------EKG-FAVTVVDNFHNSVPEALDRVRLI-AGaA---LSARLDFIAGDL 88 
219120947   2 NRAIFRTVLVTGGAGYIGSHTCLELL-------ESKtYKVVVIDNLDNSSEESIKRVQQL-TAcG----KDDLVFRNCDI 69 
224000954   2 SSLIHKRILVTGGCGYIGSHTLIALLdpsnvanTNTqYSIVVVDNLVNSSHESLKRVAAIsAGqD---ANERLVFRKVDC 78 
225426811   1 MALYDRTILVTGGAGFIGTHTVVQLL-------SEG-FTVWIIDNLDNSVLEAIERVRDL-VGaE---LSRKLHFNLGDL 68 
242049918  13 AAAGRRSVLVTGGAGFIGTHTVLRLL-------EQG-YGVTVVDNFHNSVPEALDRVRLI-AGpA---LSARLDFIRGDL 80 
255079646   2 APVEGSTVLVTGGAGYIGSHTCLQLL-------AAG-CKVVVVDNLDNSSEESLRRVKEL-IP-D---KADNLVFHNCDI 68 
302852016   1 MSLEGKNIFVTGGLGFIGSHTVLVLL-------DHG-AKVHLIDNLSNSFPRVFEHMKKL-AG-D---KADKMTYTKCDI 67 
219118249  72 CDEAAFRKV---FESSpRFESCIHFAGLKAVGESTKKPLLYYDNNLSGTFVLLRMMDEFQCHSLVFSSSATVYGAAENMP 148
159481273  68 NDKETLTTI---FEKE-HFDCVIHFAGYKAVGESVDKPLEYYHNNFVGTVILLEVMRAHKCKNMVFSSSCTVYGMPDEVP 143
145349820  67 RDAEALEDV---FATCgTVRAVIHFAGLKAVGESVAKPLLYYENNIRSTLTLCETMARHGCKTLCFSSSATVYGEPASVP 143
115480267  89 KSKDDMEKV---FAAK-RYDAVIHFAGLKAVGESVAHPQMYYENNVAGTMNLYSAMTKYGCKKIVFSSSATVYGQPEKTP 164
219120947  70 RDRRRLKAV---LDEFpNISSCIHFAGLKAVGESVSKPLMYYDCNVGGTVQLLEQLNNKGIKNFVFSSSATVYGEPEMLP 146
224000954  79 CNKAGFRAVfeeFASKgGFDAAVHFAGLKAVGESKLIPLKYYEDNLGATLTLLNLMEEYGCRTIVFSSSATVYGIAKDEK 158
225426811  69 RNKADLEKL---FSQT-KFDAVIHFAGLKAVGESVVNPRRYFDNNLIGTINLYEIMAKYNCKKMVFSSSATVYGQPDKIP 144
242049918  81 RSTEDLEKV---FSAR-RYDAVIHFAGLKAVGESVAHPEMYYENNLVGTINLYKTMKERVRVQLVFSSSATVYGWPEEIP 156
255079646  69 LDREGLDKA---FAAQ-KVDAVIHFAGLKAVGESVAQPMRYYSNNIVGTVVLIEVMEKHGCKAMIFSSSATVYGEPATVP 144
302852016  68 NDEEGLTKI---FEKE-TFDCVIHFAGFKAVGESVEKPLEYYHNNFVGTVILLEVMRKFKLKNMVFSSSCTVYGLPEKVP 143
219118249 149 I----TEDTPVGAgiTNAYGRTKYMIEEILRDFYQSqTLEest-------tdWSITILRYFNPVGSHPSGKIGEDPNGIP 217
159481273 144 I----TESAPLKA--ISPYGRTKLFQEDMFRDLAVS-DKD------------WRILLLRYFNPIGAHPSGELGEHPVGIP 204
145349820 144 C----TEDFPTAA--LNPYGRTKLFIEHILSDLQKS-DGE------------WRVALLRYFNPVGAHESGTLGEDPKGIP 204
115480267 165 C----VEDSKLSA--LNPYGTTKLVLENYFRQVQAA-DPE------------MRVILLRYFNPIGAHRSGDIGEDPRGIP 225
219120947 147 L----VETARLQA--TNPYGRTKLFIEEILRDCHAS-DDS------------WNTLILRYFNPIGAHPSGKIGEDPQGIP 207
224000954 159 AklkeTDEVGVTI--TNCYGRTKFMIEQILNDFHGS-QALlrekakndeakdWSIGILRYFNPVGAHPSGTMGEDPRGVP 235
225426811 145 C----VEDFNLMA--MNPYGRTKLFLEEIARDIQKA-EPD------------WKIILLRYFNPVGAHESGKLGEDPKGIP 205
242049918 157 C----VEDSKLQA--ANPYGRTKLILEDMARDYHRA-DPE------------WSIVLLRYFNPIGAHSSGEIGEDPKGIP 217
255079646 145 C----TEDFPTAA--LNPYGRTKLFIEHILTDLQHS-KPD------------WQVVLLRYFNPVGAHPSGRIGEDPKGIP 205
302852016 144 I----TEEAPLKA--ISPYGRTKLFQEDMFRDIAVG-DKE------------WRILLLRYFNPIGAHPSGDLGEHPVGIP 204
219118249 218 NNLMPYVAQVAIGRREHLTVFGSDYNTADGTGVRDYLHVMDLADGHLAAMDYM-----KQKKSGIFTFNLGTGNGYSVLD 292
159481273 205 NNLMPYIQQVALGQREFLRVFGNDYPTPDGTAIRDYIHVMDLAEGHVSAVVKTl----ATPDLGCTPINLGTGKGTSVLE 280
145349820 205 NNLMPFVQQVAVGRRAELSVFGNDYPTKDGTGRRDYIHVVDLADGHVAAVKKLt----TDPNAGLITVNLGTGTSTSVLE 280
115480267 226 NNLLPYIQQVAVGRRPELNVYGVDYPTRDGTAIRDYIHVVDLADGHIAALEKLf----ATPDIGCVAYNLGTGCGTTVLE 301
219120947 208 NNLMPFVAQVCVGRREKLSVFGDDYDTPDGTGVRDYIHVVDLAKGHVAALEKL-----YSDQVGCRAVNLGTGQGVSVLE 282
224000954 236 NNLMPFVAQVAVGRRPHVTIFGNDYDTPDGTGVRDYLHVMDLADGHVAALRYMdggnkNNGTGKLNVFNLGTGIGYSVLD 315
225426811 206 NNLMPYIQQVAVGRLPELNVYGHDYPTRDGSAIRDYIHVMDLADGHIAALRKLf----TSEDIGCTAYNLGTGQGTSVLE 281
242049918 218 NNLLPYIQQVAVGRLPELNVYGHDYPTRDGTAIRDYIHVVDLADGHIAALNKLf----DAPDIGCVAYNLGTGRGTSVLE 293
255079646 206 NNLMPYVQQVAVGRRERLSVYGDDYPTPDGTGKRDYIHVMDLADGHVAALRKVr----NDPNSGCITVNLGTGKSTSVLE 281
302852016 205 NNLMPYIQQVALGQREFLRVFGSDYPTPDGTAIRDYIHVMDLAEGHVSAVVKVl----ATPDLGCTPINLGTGKGSSVLE 280
219118249 293 MVKAMGKACGHEIKYVVGNRRQGDIATCFADANLAKNEMGWVASRDLDEMCRDLWCWQTQNPNGFAGQPCES 364
159481273 281 MIKAFENASGKKVEHKLVDRRPGDSVAVWAATETAEEKLGWKSKYDVDDMCKHQWAWASKYPQGYETPL--- 349
145349820 281 LVAAFEKASGKKIPCKMVARREGDAAEVYGATQKAFEVLGWRAERTIEDCCKDQWKWASANPYGYLGKPDDE 352
115480267 302 VVKAFEEASGKKIPIKICPRRPGDCTEVYASTDKAKKELGWSARFGIEDMCRDQWNWAKKNPYGYSANAEQN 373
219120947 283 LVKGMGKATGKAVPYEISPRRPGDVATVYADASLAQELLGWKAELGVDAMCEDTWRWQSTNPNGYQQQVQDI 354
224000954 316 MVEAMGKACGKPIPYVLGPRRPGDVTIYVADPSRAKEEMGWSAKFGLDDMCNDLWKWQTQNPNGYE------ 381
225426811 282 MVAAFEKASGKKIPIKLCPRRAGDATAVYASTEKAAKELGWKAKYGIAEMCRDQWKWASNNPWGYHSKP--- 350
242049918 294 MVAAFKKASGKEIPTKLCPRRPGDATEVYASTEKAGRELGWRAQYGIEEMCRDQWNWAKKNPYGYCGSAEK- 364
255079646 282 LVAAFAKAAGKEIPMQIAPRRPGDAAEVYAKTDRAKEVLGWEAKFSIEECCVDQWKWASENPYGYGQAE--- 350
302852016 281 MVRAFEAASDKKVEYKLMDRRPGDSVAVWAATETAEKELGWKSN-TMSTTC------ASTNGLGRPSTRRAT 345
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap