Conserved Protein Domain Family
PLN02236

?
PLN02236: PLN02236 
choline kinase
Statistics
?
PSSM-Id: 177880
View PSSM: PLN02236
Aligned: 24 rows
Threshold Bit Score: 600.108
Threshold Setting Gi: 168046258
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
115439587   8 SQGQRAAEAAAQPRIPREARRLLHEMAAS-WADVADC-----RALQVIPLKGAMTNEVYQVRWLNGAPATAdggeveaea 81 
168046258   1 ---------------------MLHKLARK-WTDILDP-----KDLTLTRLKGAMTNYVYQCHWERDNGHRP--------- 44 
242088613  16 QSPAEAAPVPTARSIPDEARRLLHELAAA-WEDVAVAgcggrREPEVVPLKGAMTNEVYQARWAITTTTGGggaea---- 90 
242056163  15 APAPVLKRSTSIDRIPEDARRILHRLAGDlWGSDVDP-----SALTVSQLKGAMTNEVFRITWPGGEGDP---------- 79 
242058527  15 VAAEAVPVPVPGPRIPREARSLLHELAAA-WADVADC-----RALEVVPLKGAMTNEVYQVRWLTGPAAAGekeepr--- 85 
225464027   1 MGAVEDRVNNKAGRLPGEARRILLSLASS-WDNVTDS-----NALQVIPLKGAMTNEVYQIKWPTSTGETS--------- 65 
224073007   1 MGAVENPVDNKEYRIPGEAKEILKSLASK-WEDVADA-----NSLQVIPLKGAMTNEVFQIKWPTKTENVS--------- 65 
224057232   1 MGPVENPVNNKEYRIPGEAKEMLKSLASK-WEDIDDA-----NSLQVIPLKGAMTNEVFQIKWPTKTQNMS--------- 65 
255569147   1 MGAVENAIVNKESRIPLEAKEILKSIASK-WEDVVDA-----NALQIIPLKGAMTNEVFQIKWPTKTENGS--------- 65 
302787302   1 -MGSLDDSEVSSGIIPSEVFPLLHKLAGK-WPDVLDA-----LDVTWRPLKGAMTNHIYECQWPGGSGRVGeq------- 66 
115439587  82 aarerevRKVLVRIYGDGVELFFDREDEVRTFECMSRHGQGPRLLGRFTNGRVEEFIHARTLSAADLRDPEISALVASKL 161
168046258  45 -------RTVLVRIYGEGSSMFFNRNDEVLTFELMSQKGQGPHLLGRFPNGRVEEFLRARTLEKHDLRDPEISKRIAEKL 117
242088613  91 ---grdaRTVLVRVYGEGVDLFFDREDEVRTFEFMSRHGLGPRLLGRFPNGRVEEFIHARTLSAPDLRDPEISAIIASKL 167
242056163  80 -------RKVLVRIYGRGVEVFFDRADEVRTFECMSRHGQGPRLLGRFANGRVEEFIYARTLSAADLRDPEISALIAKKL 152
242058527  86 --rerevRKVLVRIYGDGVDLFFDREDEVRTFECMSRHGQGPRLLGRFPNGRVEEFIHARTLSAADLRDPEISALVASKL 163
225464027  66 -------RKVLVRIYGEGVEVFFDRASEIQTFEFISKHGQGPRLLGRFPNGRIEEFIHARTLSAADLHDPDISDLIAIKM 138
224073007  66 -------HKVLVRIYGEGVEVFFDRENEIHTFEFISKQGQGPRLLGRFSNGRIEEFIHARTLSASDLRDPDMSALIAAKM 138
224057232  66 -------RKVVVRIYGEGVEVFFDRDTEILTFEFMSKQGQGPRLLGRFSNGRIEEFIHARTLSASDLHDPDISALIAAKM 138
255569147  66 -------HKVLVRIYGEGVEIFFDRDDEIKTFEFMSKQGQGPRLLGRFSNGRIEEFIHARTLSACDLRDPDISALIAAKL 138
302787302  67 ------qRKALVRIYGDSVDILFKREDEVRIFEFVSRKGQGPRLLGRFPNGRVEEFIHARTLTAADLRDPGISARIAAKM 140
115439587 162 REFHNLDMPGPKSVLIWDRLK-NWLKTARNLCSSDESKKFRLGSLENEIAALEKEFSGDYHGIGFCHNDLQYGNIMIDED 240
168046258 118 QEFHSLDMPGPRKAKLWERLR-DWLVKIFEHSDSTE-EDFGINKLDDEINDLQRRLMKPDTRIGFCHNDLQYGNIMVSEK 195
242088613 168 REFHSLDMPGSKYVLIWERLR-NWLKTAKSLYSSDEAKEFCLDSMEEEITALENEFSEECERVGFCHNDLQYGNIMIDEE 246
242056163 153 REFHDLDMPGPRDVSLWQRLR-RWLEEARGRCSEQEFNQFQLDKLGDEIAVLEKTLSGVEQSVGFCHNDLQYGNIMIDEE 231
242058527 164 REFHNLDMPGPKSVLIWDRLR-NWLRTAKNLCPSEEAKEFRLDSLENEITALENECSGDYQWIGFCHNDLQYGNIMIDEE 242
225464027 139 KEFHDLNMPGPKDVVLWDRMR-DWLSAAKNLSSPEEANTFQLDAIEEEISLLEKKLPGNHLHIGFCHNDLQYGNIMIDEE 217
224073007 139 KEFHGLEMPGPKNISLWDRLR-NWLETAKRLCTPEEAKPFRLDSIEEEISLLEKELSG-DRSIGFCHNDLQYGNIMIDEK 216
224057232 139 KEFHGLEMPGPKDVSLWHRLRlNWLKTAKSLCTPEEAKDFRLDSIGDEISLIEKELSG-DQSIGFCHNDLQYGNIMIDEE 217
255569147 139 KEFHGLEMPGSKNVSLWIRLR-NWLNTAKSMCPPEEAKAFHLDTIEVEISLLEKELSG-DQRIGFCHNDLQYGNIMIDEE 216
302787302 141 WEFHRLDLPESHEPKLWERLR-DWLQKAEKLCSPQSMQEFHMKRLESEIREAERTIPEPGDVIGFCHNDLQYGNIMHNDA 219
115439587 241 TNMLTIIDYEYASFNPVAYDIANHFCEMAADYHSEKPHRLDYSKYPD------TDEQKRFVKTYLSNSvSEEPDAEEVEN 314
168046258 196 DDSITLIDYEYASYNPVAFDIANHFCEMTADYHSDEPHLLNQASFPD------YEERSRFCRAYLEAS-GDSATQIDVER 268
242088613 247 TKLLTIIDYEYASFNPVAYDIANHFCEMAADYHSEKPHILDYSKYPD------TNERKKFVQTYLSSS-GEE-SEVEVEN 318
242056163 232 TRQVTLIDYEYASFNPIAFDIANHFCEMAADYHTATPHELDFTKYPG------IEEQRRFVQTYLCSA-GEKPSDGEVEK 304
242058527 243 TNVLTIIDFEYASFNPVAYDIANHFCEMAADYHSSKPHILDYSRYPD------VDEQKRFVKTYLNIS-GEEPDAEVVEN 315
225464027 218 TSLITIIDYEYASYNPVTYDIANHFCEMAADYHTETPHILDYSKYPS------LEKRQRFLRIYLGHA-GDQPNDLELEV 290
224073007 217 TRVITIIDYEYASYNPIAFDIANHFCEMTADYHTDTPHILDYSKYPG------LDERQRFLRVYLSSS-GGQPSDNEVEQ 289
224057232 218 TRSITIIDYEYASYNPIAFDIANHFCEMTADYHTDTPHILDYSKYPG------LEERQRFLHLYLSSS-GGLPSDIELEQ 290
255569147 217 TKAITIIDYEYSSYNPIAFDIANHFCEMAADYHSNTPHIMDYSKYP-----------------------GDRVSDIEVEQ 273
302787302 220 TDALTIIDYEYASYNPVAFDIANHFCEMAADYHTESPHRLDYAKYPGkyfspyEDERRRFIEAYLDSS-GSKASRGDVDT 298
115439587 315 LLQSIEKYTLASHLVWGLWGIISDHVND-IDFDYKEYARQRFEQYWQKKQALLTS 368
168046258 269 FVKEVDEFVVASHLHWALWGLLSAAHQD-VEFDFFSYSRQRFAEYYRLKHDLFGS 322
242088613 319 LIKSIENYTLASHLVWGLWGIISDHVND-IDFDYKEYARQRFEQYWLKKPTILTS 372
242056163 305 LLGLIAKYTPASHLFWGLWGIISAHVNNnIDFEYKEYARQRLDQYWQTKPGMLGP 359
242058527 316 LLQRIDKYMLASHLVWGLWGIISDHVND-IDFDYKEYARQRFEQYWQKKSAILTS 369
225464027 291 LVQDVEKYTLASHLLWGLWGIISEHVNE-IDFNYMEYARQRFEQYWLRKPELLGS 344
224073007 290 LIENVEKYKLASHLFWGLWGIISEHVNE-IDFDYMEYARQRFGQYWLRKPALLGS 343
224057232 291 LLENVEKYKLASHLFWGLWGIISEHVNE-IDFDYMEYARQRFEQYCLRKPALLGS 344
255569147 274 LLEDVEKYTLASHLFWGLWGIISEHVNE-IDFDYMEYARQRFEQYWLRKPELLGS 327
302787302 299 LLLRVDLYELASHLHWGLWGIISVPISD-IDFDFLEYARQRFQRYDERKRELWPR 352
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap