Conserved Protein Domain Family
PLN02235

?
PLN02235: PLN02235 
ATP citrate (pro-S)-lyase
Statistics
?
PSSM-Id: 177879
View PSSM: PLN02235
Aligned: 25 rows
Threshold Bit Score: 775.098
Threshold Setting Gi: 159485736
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
302849248   1 MARKKIREYDAKRLLKAHIKRLAGLDLPIQVVQFTAASNPSDLLNENPWLGNTRLVVKPDMLFGQRGKNDLVGLNLDFSQ 80 
168022395   1 MARKKIREYNSKRIFKEHLKRLAGIDVDIKAAQVTQSTDFNELANKEAWLNSTRLVVKPDMLFGKRGKSGLVALNLDLAG 80 
168000813   1 MARKKIREYDSKRILKEHLKKLAGIDIAIKSAQVTESTDFTKLAEQEPWLNSTRLVVKPDMLFGKRGKSGLVALNLDLAG 80 
15217510    1 MARKKIREYDSKRLLKEHLKRLANIDLQIRSAQVTESTDFTELTNQESWLSSTKLVVKPDMLFGKRGKSGLVALKLDLAE 80 
224124562   1 MARKKIREYDSKRLLKEHLKRLSGIDLQICSAQVTEGTDFTELTNKEPWLSSTKLVVKPDMLFGKRGKSGLVALNLDLAQ 80 
224124954   1 MARKKIREYDSKRLLKEHLKRLSGIDLLIRSAQVTEGTDFTELTNQEPWISSTKLVVKPDMLFGKRGKSGLVALNLDLAQ 80 
225450474   1 MARKKIREYDSKRLLKDHLKRLAGIDLQICSAQVTEATDFAELTNKEPWLSSTRLVVKPDMLFGKRGKSGLVALNLDLAQ 80 
255543008   1 MARKKIREYDSKRLLKEHLKRLAGLDIQICSAQVTESTDFTELTNQEPWLSSSRLVVKPDMLFGKRGKSGLVALNLDLAQ 80 
297843736   1 MARKKIREYDSKRLLKEHLKRLANIDLQIRSAQVTESTDFTELTNQESWLSSTKLVVKPDMLFGKRGKSGLVALKLDLAE 80 
302775344   1 MARKKIREYDSKRLLKQHLKRLASIDLALHSAQVTQETDFDALADKEPWLNSTRLVVKPDMLFGKRGKSGLVALNLDLAG 80 
302849248  81 ASTmcfpsaiwaidFATQRLNRTVTVNGCTGPITTFLIEPFVAHEEEFYLSITSTRNGWEVSFSEAGGIHIEENWDKLRT 160
168022395  81 VES-----------FVKDRLGKEVEMSGTKGPITTFIVEPFVPHSDEFYLSIVSDRLGANISFSECGGIEIEENWEKVRS 149
168000813  81 VVA-----------FVKERLGKEVEMSGTKGPITTFIVEPFVPHKDEYYLSIVSDRLGVNVSFSECGGIDIEENWDKVKA 149
15217510   81 VAD-----------FVKARLGTEVEMEGCKAPITTFIVEPFVPHDQEYYLSIVSDRLGCTISFSECGGIEIEENWDKVKT 149
224124562  81 VAE-----------FVKARLGAEVEMGGCKAPITTFIVEPFVPHDQEFYISIVSERLGSTISFSECGGIEIEENWDKVKT 149
224124954  81 VAD-----------FVKARLGVEVEMGGCKAPITTFIVEPFVPHDQEFYFSIVSERLGCTISFSECGGIEIEENWDKVKT 149
225450474  81 VAE-----------FVKARLGVEVEMGGCKAPITTFIVEPFVPHDQEYYLSIVSDRLGCTISFSECGGIEIEENWDKVKT 149
255543008  81 VAE-----------FVKARLGVEVEMSGCKAPITTFIVEPFVPHDQEFYLSIVSERLGCTISFSECGGIEIEENWDKVKT 149
297843736  81 VAA-----------FVKARLGTEVEMEGCKAPITTFIVEPFVPHDQEYYLSIVSDRLGCTISFSECGGIEIEENWDKVKT 149
302775344  81 VEA-----------FVKERLGREVEMDGTKAPITTFIVEPFIPHDSEFYLSLVSHRLGVEISFSECGGIEIEENWEKVKT 149
302849248 161 VVLDTTDcPLDSARVAPLIAGLPLELKPALERFILAAFAVFNDLDCTLLEMNPWTLdASGQPFPLDMRVELDDTSKYRNG 240
168022395 150 VFIPTEK-TLTSELCAPLIATLPLEVRPIIEAFLKGSFAVFEDLDFTLLEMNPFTL-VNNVPLPLDMRGELDDTALFKNF 227
168000813 150 IFVPTEQsTLTSEICAPLVATLPLEVRPKIEEFLKGVFIVFSELDFTLLEMNPFTI-VDGTPYPLDMRGELDDTALFKNT 228
15217510  150 IFLPAEK-SMTLEVCAPLIATLPLEVRAKIGNFIMGAFAVFQDLDFSFMEMNPFTL-VDGEPFPLDMRGELDDTAAFKNF 227
224124562 150 IFLPTEK-PMTLEACAPLIATLPLEIRGKIGDFIISVFSVFQDLDFSFLEMNPFTL-VNGEPYPLDMRGELDDTAAFKNF 227
224124954 150 IFLPTEK-PMTLEACAPLIATLPLEIRGKIVDFIICVFSVFQDLDFSFLEMNPFTL-VNGEPYPLDMRGELDDTAAFKNF 227
225450474 150 INLPTEK-PMTPETCAPLIATLPLEVRGKIGDFIKGAFAVFQDLDFSFLEMNPFTL-VNGEPYPLDMRGELDDTAAFKNF 227
255543008 150 VFLPTEK-PMNLEACAPLIATLPLEIRGKIGAFIMGVFAVFQDLDFSFIEMNPFTL-VNGEPYPLDMRGELDDTAAFKNF 227
297843736 150 IFLPAEK-SMTLEVCAPLIATLPLEVRAKIGNFIMGAFAVFQDLDFSFMEMNPFTL-VDGEPYPLDMRGELDDTAAFKNF 227
302775344 150 VFVPTEQ-PLTAETCAPLIATLPLEIRGKIETFIRGVFSVFEDLDFSLIEMNPFTL-VNGEPYPLDMRGELDDTALFKNF 227
302849248 241 PKWNvgdvELEFPLPFGRLLTPAEEAVSALDEATGASLKFTVLNPAGRVWLMVAGGGASVIYTDTIADLGFAQELGNYGE 320
168022395 228 QKWG----NVEFPLPFGRTMTPAEESIHRMDEKTGASLKLTILNPKGRIWTMVAGGGASVIYADTVGDLGYAHELGNYAE 303
168000813 229 QKWG----NVEFPLPFGRTMSPAEEKIHRMDEKTGASLKLTILNPEGRIWTMVAGGGASVIYSDTVGDLGFASELGNYAE 304
15217510  228 NKWG----DIEFPLPFGRVLSSTENFIHGLDEKTSASLKFTVLNPKGRIWTMVAGGGASVIYADTVGDLGYASELGNYAE 303
224124562 228 KKWG----NVEFPLPFGRVLSSTESFIHSLDEKTSSSLKFTVLNPKGRIWTMVAGGGASVIYADTVGDLGYASELGNYAE 303
224124954 228 KKWG----NIEFPLPFGRVLSSTESFIHSLDEKTSASLKFTVLNQKGRIWTMVAGGGASVIYADTVGDLGYASELGNYAE 303
225450474 228 KTWG----NIEFPLPFGRVLSPTEGYIHSLDEKTSASLKFTVLNPKGRIWTMVAGGGASVIYADTVGDLGYASELGNYAE 303
255543008 228 KKWG----NIEFPLPFGRVLSPTESFIHSLDEKTSASLKFTVLNPKGRIWTMVAGGGASVIYADTVGDLGYASELGNYAE 303
297843736 228 NKWG----DIEFPLPFGRVLSSTESFIHGLDEKTSASLKFTVLNPKGRIWTMVAGGGASVIYADTVGDLGYASELGNYAE 303
302775344 228 QKWG----NVEFPVPFGRVMTPAEESIHKMDEKTGASLKLTILNPKGRIWTMVAGGGASVIYADTVGDLGYAHELGNYAE 303
302849248 321 YSGAPNTSETYQYARTVLDCATAHADGRGRVLLIGGGIANFTDVAATFTGIIQALKEKKAALQAAKVRIFVRRGGPNYQK 400
168022395 304 YSGAPNEEETLQYARALIDCCTANPDGRKRALVVGGGIANFTDVAATFNGIIRAMREKQSHLKAARVNIFVRRGGPNYLK 383
168000813 305 YSGAPNEEETLHFARALIDCCTANPDGRRRALVVGGGIANFTDVAATFNGIIRAFREKESQLKAARVQIYVRRGGPNYQK 384
15217510  304 YSGAPNEEEVLQYARVVIDCATTDPDGRKRALLIGGGIANFTDVAATFNGIIRALREKETRLKASRMHIYVRRGGPNYQT 383
224124562 304 YSGAPNEDEVLQYARVVIDCATSDPDGRKRALLIGGGIANFTDVAATFNGIIRALREKESKLKAARMHIYVRRGGPNYQT 383
224124954 304 YSGAPNEEEVLQYARVVIDCATADPDGRKRALLIGGGIANFTDVAATFNGIIRALREKESKLKAARMHLYVRRGGPNYQT 383
225450474 304 YSGAPNEEEVLQYARVVLDCATADPDGRKRALLIGGGIANFTDVAATFNGIVRALKEKESKLKASRMHIYVRRGGPNYQT 383
255543008 304 YSGAPNEEEVLQYARVVIDCATADPDGRKRALLIGGGIANFTDVAATFNGIIRALREKESKLKAARMHIYVRRGGPNYQT 383
297843736 304 YSGAPNEEEVLQYARVVIDCATADPDGRKRALLIGGGIANFTDVAATFNGIIRALREKETRLKASRMHIYVRRGGPNYQT 383
302775344 304 YSGAPSEEETLHYARALIDCVTANPDGRRRALLIGGGIANFTDVAATFNGIIRALREKESQLKVAKVHIFVRRGGPNYQK 383
302849248 401 GLALMRSLGDELGVPIGVYGPESSMTGICAEAIDYLKQQD 440
168022395 384 GLANMRALSEETGVPIEVYGPEASMTGICKQAIDYISARD 423
168000813 385 GLAKMRELGAEIGIPIEVYGPEASMTGICKQAIDYISIAA 424
15217510  384 GLARMRALGEELGVPLEVYGPEATMTGICKRAIDCIMLPD 423
224124562 384 GLAKMRTLGEELGVPLEVYGPEATMTGICKQAIDCIMSTA 423
224124954 384 GLAKMRTLGEEVGVPLEVYGPEATMTSICKQAIDCIMSTA 423
225450474 384 GLARMRALGEELGIPLEVYGPEATMTGICKQAIDCIMSTA 423
255543008 384 GLAKMRTLGEEVGVPLEVYGPEATMTGICKQAIDCIMSAA 423
297843736 384 GLARMRALGEELGVPLEVYGPEATMTGICKRAIDCIMLPD 423
302775344 384 GLERMRTLGRDIGIPIEVFGPEASMTGICRNAIDYIRVAA 423
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap