Conserved Protein Domain Family
PLN02234

?
PLN02234: PLN02234 
1-deoxy-D-xylulose-5-phosphate synthase
Statistics
?
PSSM-Id: 177878
View PSSM: PLN02234
Aligned: 3 rows
Threshold Bit Score: 1239.59
Threshold Setting Gi: 297835124
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
186510290   1 MSYQTQINKFSQMALSVFAFPSYINRNPSLKYLKPSSMSSTKYSKVRATTFSEKGEYYSNRPPTPLLDTINHPMHMKNLS 80 
186510292   1 MSYQTQINKFSQMALSVFAFPSYINRNPSLKYLKPSSMSSTKYSKVRATTFSEKGEYYSNRPPTPLLDTINHPMHMKNLS 80 
297835124   1 ------------MALSVFAFPSYIYRNPSIKYCKPTSMSSTKTSKVRA-TIAEKGEYYSSRPPTPLLDTINHPMHMKNLS 67 
186510290  81 IKELKVLSDELRSDVIFNVSKTGGHLGSNLGVVELTVALHYIFNTPHDKILWDVGHQSYPHKILTGRRGKMKTIRQTNGL 160
186510292  81 IKELKVLSDELRSDVIFNVSKTGGHLGSNLGVVELTVALHYIFNTPHDKILWDVGHQSYPHKILTGRRGKMKTIRQTNGL 160
297835124  68 IKELKVLSDELRSDVIFNVSKTGGHLGSNLGVVELTVALHYIFNTPQDKILWDVGHQSYPHKILTGRRGKMKTIRQTNGL 147
186510290 161 SGYTKRRESEHDSFGTGHSSTTLSAGLGMAVGRDLKGMNNSVVSVIGDGAMTAGQAYEAMNNAGYLHSNMIVILNDNKQV 240
186510292 161 SGYTKRRESEHDSFGTGHSSTTLSAGLGMAVGRDLKGMNNSVVSVIGDGAMTAGQAYEAMNNAGYLHSNMIVILNDNKQV 240
297835124 148 SGYTNRRESEHDSFGTGHSSTTISAGLGMAVGRDLKGMNNSVVAVIGDGAMTAGQAYEAMNNAGYLDSDMIVILNDNKQV 227
186510290 241 SLPTANLDGPTQPVGALSCALSRLQSNCGMIRETSSTLFEELGFHYVGPVDGHNIDDLVSILETLKSTKTIGPVLIHVVT 320
186510292 241 SLPTANLDGPTQPVGALSCALSRLQSNCGMIRETSSTLFEELGFHYVGPVDGHNIDDLVSILETLKSTKTIGPVLIHVVT 320
297835124 228 SLPTANLDGPTPPVGALSCALS---------SGTGSTLFEELGFHYVGPVDGHNIDDLVSILEKVKSTKPIGPVLIHVVT 298
186510290 321 EKGRGYPYAERADDKYHgVLKFDPETGKQFKNISKTQSYTSCFVEALIAEAEADKDIVAIHAAMGGGTMLNLFESRFPTR 400
186510292 321 EKGRGYPYAERADDKYH-VLKFDPETGKQFKNISKTQSYTSCFVEALIAEAEADKDIVAIHAAMGGGTMLNLFESRFPTR 399
297835124 299 EKGRGYPYAERADDKYHgVLKFDPATGKQFKNISKTQSYTSCFVEALTAEAEADKNIVAIHAAMGGGTMLNLFESRFPTR 378
186510290 401 CFDVGIAEQHAVTFAAGLACEGLKPFCTIYSSFMQRAYDQVVHDVDLQKLPVRFAIDRAGLMGADGPTHCGAFDVTFMAC 480
186510292 400 CFDVGIAEQHAVTFAAGLACEGLKPFCTIYSSFMQRAYDQVVHDVDLQKLPVRFAIDRAGLMGADGPTHCGAFDVTFMAC 479
297835124 379 CFDVGIAEQHAVTFAAGLACEGLKPFCTIYSSFMQRAYDQVVHDVDLQKLPVRFAIDRAGLMGADGPTHCGAFDVTFMAC 458
186510290 481 LPNMIVMAPSDEAELFNMVATAAAIDDRPSCFRYHRGNGIGVSLPPGNKGVPLQIGRGRILRDGERVALLGYGSAVQRCL 560
186510292 480 LPNMIVMAPSDEAELFNMVATAAAIDDRPSCFRYHRGNGIGVSLPPGNKGVPLQIGRGRILRDGERVALLGYGSAVQRCL 559
297835124 459 LPNMIVMAPSDEAELFNMVATAAAIDDRPSCFRYHRGNGIGVSLPPGNKGVPLQIGKGRILREGERVALLGYGSAVQRCL 538
186510290 561 EAASMLSERGLKITVADARFCKPLDVALIRSLAKSHEVLITVEEGSIGGFGSHVVQFLALDGLLDGKLK-----VYRTWI 635
186510292 560 EAASMLSERGLKITVADARFCKPLDVALIRSLAKSHEVLITVEEGSIGGFGSHVVQFLALDGLLDGKLK-----VYRTWI 634
297835124 539 EAASMLSERGLKITVADARFCKPLDVALIRSLVKSHEVLITVEEGSIGGFGSHVVQFLALDGLLDGKLKwrpmvLPDRYI 618
186510290 636 TNGSTS 641
186510292 635 TNGSTS 640
297835124 619 EHGSPM 624
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap