Conserved Protein Domain Family
PLN02233

?
PLN02233: PLN02233 
ubiquinone biosynthesis methyltransferase
Statistics
?
PSSM-Id: 177877
View PSSM: PLN02233
Aligned: 5 rows
Threshold Bit Score: 467.831
Threshold Setting Gi: 224102453
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
79350735    1 MAALLGIVSPVTFTGKHPVNSRSRRRTVVKC----SNERRILFNRIAPVYDNLNDLLSLGQHRIWKNMAVSWSGAKKGDY 76 
242076410   2 VALTAGISVAAGVVFSPAGRRRGRGPDAFRCsassAGERQALFSRIAPVYDLLNDVLSLGQHRTWKRICVSWSRVKMGDR 81 
225425607   1 MASLHFLLRPSSNPNLLALPSRSRP---VQC----ANERQALFSRIAPVYDNLNDFLSLGQHRIWKRMAVSWSGAKRGDD 73 
224102453   1 -----------------------------------ANDRQLLFNRIAPVYDNLNDLLSLGQHRIWKRMAVSWTGAKLGDC 45 
297850802   2 AALVLGIVSPVTFTGKLLPNSRSRRRMVVKC----SNERRILFNRIAPVYDNLNDLLSFGQHRIWKNMTVSWSGAKTGDN 77 
79350735   77 VLDLCCGSGDLAFLLSEKVGSTGKVM---GLDFSSEQLAVAATRQSLKARSCYKCIEWIEGDAIDLPFDDCEFDAVTMGY 153
242076410  82 VLDLCCGSGDLAFLLSQKVGLDGEVM---AVDFSRQQLQTAADRQEQRWKLCYKNIKWIEGDALDLPFTDCYFDAVTVGY 158
225425607  74 VLDLCCGSGDLAFLLSERVGSDGKVLisqGSNYRLLHLDNTCSQKP--ATRTLSEHWWIEGDATKLPFSDCSFDAITMGY 151
224102453  46 VLDLCCGSGDLAFLLSEKVGSNGKVS---GLDFSKEQLLMASSRQHLLSKACYKNIEWIEGDATELPFPDCYFDAITMGY 122
297850802  78 VLDLCCGSGDLAFLLSEKVGSTGKVL---GLDFSSEQLAVAASRQNLKARSCYKCIEWIEGDAIDLPFDDCEFDAITMGY 154
79350735  154 GLRNVVDRLRAMKEMYRVLKPGSRVSILDFNKSNQSVTTFMQGWMIDNVVVPVATVYDLAKEYEYLKYSINGYLTGEELE 233
242076410 159 GLRNVVNKSKAMREIYRVLKPGSRASILDFNKSSSLFTASLQSWAIDNVVVPLASGYGLTEEYKYLKSSIAQYLTGEELE 238
225425607 152 GLRNVLDRGKAMQEMFRVLKPGSRVSILDFNKSTKPFITSIQEWMIDNVVVPVATGYGLADEYAYLKSSVQEFLTGKELE 231
224102453 123 GLRNVVDKRKAVQEMFRVLKPGSKASVLDFNKSTQPFVASFQEWMIDNAVVPVATAYGLAKEYEYLKGSIREFLTGNELE 202
297850802 155 GLRNVVDRLRAMKEMYRVLKPGSRVSILDFNKSNQSVTTFMQDWMIDNVVVPVATVYGLAKEYEYLKYSINGYLTGEELE 234
79350735  234 TLALEAGFSSACHYEISGGFMGNLVAMR 261
242076410 239 KLAKEAGFCAAKHYELGGGLMGNLVATR 266
225425607 232 KLALEMGFSNAKHYEIGGGIMGNLVAKR 259
224102453 203 ELALEAGFSTAKHYEISGGLMGNLVATR 230
297850802 235 TLALEAGFSSACHYEISGGFMGNLVAER 262
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap