Conserved Protein Domain Family
PLN02232

?
PLN02232: PLN02232 
ubiquinone biosynthesis methyltransferase
Statistics
?
PSSM-Id: 165876
View PSSM: PLN02232
Aligned: 2 rows
Threshold Bit Score: 340.128
Threshold Setting Gi: 42571607
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
42571607   1 MGLDFSSEQLAVAATRQSLKARSCYKCIEWIEGDAIDLPFDDCEFDAVTMGYGLRNVVDRLRAMKEMYRVLKPGSRVSIL 80 
42571609   1 MGLDFSSEQLAVAATRQSLKARSCYKCIEWIEGDAIDLPFDDCEFDAVTMGYGLRNVVDRLRAMKEMYRVLKPGSRVSIL 80 
42571607  81 DFNKSNQSVTTFMQGWMIDNVVVPVATVYDLAKEYEYLKYSINGYLTGEELETLALEAGFSSACHYEISGGFMGNLVAMR 160
42571609  81 DFNKSNQSVTTFMQGWMIDNVVVPVATVYDLAKEYEYLKYSINGYLTGEELETLALEAGFSSACHYEISGGFMGNLVAMR 160
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap