Conserved Protein Domain Family
PLN02231

?
PLN02231: PLN02231 
alanine transaminase
Statistics
?
PSSM-Id: 177876
View PSSM: PLN02231
Aligned: 9 rows
Threshold Bit Score: 995.218
Threshold Setting Gi: 115481822
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
42562119    1 MRRFVIGQAKNLIDQSRRRqlhHHKNLSFVSLIPPFSAPsdssSRHlsSSSSSDMSASDSSSSLPVTLDTINPKVIKCEY 80 
30698866    1 MRRFLINQAKGLVDHSRRQh--HHKSPSFLSPQPRPLASsppaLSRf-FSSTSEMSASDSTSSLPVTLDSINPKVLKCEY 77 
115481822   1 ------------------------------------------------------------MAAPSVAVDNLNPKVLNCEY 20 
224119694   1 --------------------------------------------------------------MARVSLDTINPKVLKCEY 18 
224074105   1 --------------------------------------------------------------MPPVSLDNINPKVLKCEY 18 
225441981   1 -------------------------------------------------------------MPTPVTLETINPKVLECEY 19 
242050886   1 MRRFAADRARRAVATSLRGaasRSAAPSPHAPAPRHPAApvgaAAM--AAAMARAMSTAAVGAPPVSLNTINPKVLKCEY 78 
297839097   1 MRRFLINQAKGLVDHSRRQ---HHKSPSFLSPQSRPLAS----LSRf-FSSTSEMSASDSTSSLPVTLDSINPKVLKCEY 72 
297844672   1 MRRFVIGQAKNLIDQSRRRqhiHHKNLSFLSLLPPFSAPsdssSRHl-SSSSSEMSASDSSSSLPVTLDSINPKVIKCEY 79 
42562119   81 AVRGEIVNIAQKLQEDLKTNKDAYPFDEIIYCNIGNPQSLGQQPITFFREVLALCSYTALLDESATHGLFSSDSIERAWK 160
30698866   78 AVRGEIVNIAQKLQEDLKTNKDAYPFDEIIYCNIGNPQSLGQLPIKFFREVLALCDHASLLDESETHGLFSTDSIDRAWR 157
115481822  21 AVRGEIVIHAQRLQQQLQTQPGSLPFDEILYCNIGNPQSLGQKPVTFFREVIALCDHPCLLEKEETKSLFSADAISRATT 100
224119694  19 AVRGEIVTLAQAVQEELKSKPGSRPFDEILYCNIGNPQSLGQQPITFFREVLALCDHPSILDKSETRGLFSADAIERARQ 98 
224074105  19 AVRGEIVTLAQALQEELKSKPGSHPFDEILYCNIGNPQSLGQQPITFFREVLALCDHPSILDRSETQGLFSADAIERAWQ 98 
225441981  20 AVRGEIVTLAQRLQQELQEKPGSLPFDEILYCNIGNPQSLGQQPITFFREVIALCDHPPILDKSETQGLFSADAIERAWQ 99 
242050886  79 AVRGEIVTHAQNLQQELQKNPESLPFDEILYCNIGNPQSLGQQPVTYFREVLSLCDHPALLDKSETHALYSSDAIERAWQ 158
297839097  73 AVRGEIVNIAQKLQEDLKANKDAYPFDEIIYCNIGNPQSLGQLPIRFFREVLALCDHASLLDESETHGLFSTDSIDRAWK 152
297844672  80 AVRGEIVNIAQRLQEDLKTNKDAYPFDEIIYCNIGNPQSLGQQPITFFREVLALCSHTALLDESATHGLFSSDSIERAWK 159
42562119  161 ILDQIPGRATGAYSHSQGIKGLRDAIADGIEARDGFPADPNDIFMTDGASPGVHMMMQLLITSEKDGILCPIPQYPLYSA 240
30698866  158 ILDHIPGRATGAYSHSQGIKGLRDVIAAGIEARDGFPADPNDIFLTDGASPAVHMMMQLLLSSEKDGILSPIPQYPLYSA 237
115481822 101 ILASIPGRATGAYSHSQGIKGLRDAIAAGIASRDGYPANADDIFLTDGASPGVHMMMQLLIRNEKDGILCPIPQYPLYSA 180
224119694  99 ILDQIPGRATGAYSHSQGIKGLRDAIAAGIEARDGFPADPNDIFLTDGASPAVHMMMQLLIRSEKDGILCPIPQYPLYSA 178
224074105  99 ILDQIPGRATGAYSHSQGIKGLRDTIAAGIEARDGFPADPNDIFLTDGASPAVHMMMQLLIRSEKDGILCPIPQYPLYSA 178
225441981 100 ILDQIPGRATGAYSHSQGIKGLRDTIAAGIEARDGFPSNPNDIFLTDGASPAVHMMMQLLIRTEKDGILCPIPQYPLYSA 179
242050886 159 ILEKIPGRATGAYSHSQGVKGLRDEIAAGIAARDGFHASGDNIFLTDGASPAVHMMMQLLISSEKDGILCPIPQYPLYSA 238
297839097 153 ILDQIPGRATGAYSHSQGIKGLRDVIAAGIEARDGFPADPNDIFLTDGASPAVHMMMQLLLSSKKDGILCPIPQYPLYSA 232
297844672 160 ILDQIPGKATGAYSHSQGIKGLRDAIAAGIEARDGFPADPNDIFMTDGASPGVHMMMQLLITSEKDGILCPIPQYPLYSA 239
42562119  241 SIALHGGTLVPYYLDEASGWGLEISELKKQLEDARSKGITVRALAVINPGNPTGQVLSEENQRDVVKFCKQEGLVLLADE 320
30698866  238 SIALHGGSLVPYYLDEATGWGLEISDLKKQLEEARSKGISVRALVVINPGNPTGQVLAEENQRDIVNFCKQEGLVLLADE 317
115481822 181 SIALHGGALVPYYLNESTGWGLEISDLKKQLEDSRLKGIDVRALVVINPGNPTGQVLAEENQRDIVKFCKNEGLVLLADE 260
224119694 179 SIALHGGTLVPYYLDEATGWGLEVSELKKQWADAKSKGITPRALVVINPGNPTGQVLAENNQKEIVDFCKKEGLVLLADE 258
224074105 179 SIALHGGALVPYYLDEATGWGLEVSELKKQLADAKSKGITPRALVVINPGNPTGQVLAEDNQRGIVEFCKQEGLVLLADE 258
225441981 180 SIVLHGGTLVPYYLDEATGWGLEISELQKQLEDAKSKGITVRALVVINPGNPTGQVLSEDNQRDIVEFCKKEGLVLLADE 259
242050886 239 SIALHGGSLVPYYLDEETGWGLEVDELKKQLEEARSKGITVRALVVINPGNPTGQVLAEENQKKIVEFCKNEGLVLLADE 318
297839097 233 SIALHGGSLVPYYLDEATGWGLEISDLKKQLEEARSKGIAVRALVVINPGNPTGQVLAEDNQRDIVNFCKQEGLVLLADE 312
297844672 240 SIALHGGTLVPYYLDEASGWGLEISELKKQLEDARSKGITVRALAVINPGNPTGQVLAEENQRDIVDFCKQEGLVLLADE 319
42562119  321 VYQENVYVPDKKFHSFKKVARSMGYGEKDLALVSFQSVSKGYYGECGKRGGYMEVTGFTSDVREQIYKMASVNLCSNISG 400
30698866  318 VYQENVYVPDKKFHSFKKVARSLGYGEKDISLVSFQSVSKGYYGECGKRGGYMEVTGFTSDVREQIYKMASVNLCSNISG 397
115481822 261 VYQENIYVDNKKFNSFKKIARSMGYNEDDLPLVSFQSVSKGYYGECGKRGGYMEITGFSAPVREQIYKVASVNLCSNITG 340
224119694 259 VYQENVYVPEKKFHSFKKVARSMGYGEKDISVVSFQSVSKGYYGECGKRGGYMEVTGFGPEIREQIYKLASVNLCSNISG 338
224074105 259 VYQENVYVPEKKFDSFKKVARSMGYGEKDISLVSFQSVSKGYYGECGKRGGYMEVTGFGPEIREQIYKVASVNLCSNISG 338
225441981 260 VYQENVYVPDKKFHSFKKISRSMGYGEEDISVVSFQSVSKGYYGECGKRGGYMEVTGFGADVREQIYKVASVNLCSNITG 339
242050886 319 VYQENVYVEDKKFHSFKKIARSLGYTDDDLPLVSFQSVSKGFYGECGKRGGYMEITGFSPEVREQIYKVASVNLCSNVSG 398
297839097 313 VYQENVYVPDKKFHSFKKVARSLGYGEKDISLVSFQSVSKGYYGECGKRGGYMEVTGFTSDVREQIYKMASVNLCSNISG 392
297844672 320 VYQENVYVPDKKFHSFKKVARSMGYGEKDLALVSFQSVSKGYYGECGKRGGYMEVTGFTSDVREQIYKMASVNLCSNISG 399
42562119  401 QILASLIMSPPKPGDDSYESYIAEKDGILSSLARRAKTLEEALNKLEGVTCNRAEGAMYLFPCLHLPQKAIAAAEAEKTA 480
30698866  398 QILASLVMSPPKPGDDSYDSYMAERDGILSSMAKRAKTLEDALNSLEGVTCNRAEGAMYLFPRINLPQKAIEAAEAEKTA 477
115481822 341 QILASLVMNPPKAGDASYASYKAEKDGILQSLARRAKALENAFNSLEGITCNKTEGAMYLFPQLSLPQKAIDAAKAANKA 420
224119694 339 QILASLVMSPPKVGDESYESYSAEKDGILSSLKRRAKTLEDAFNKLDGVTCNKAEGAMYLFPCIRLSEKAIKAAEAAKTT 418
224074105 339 QILASLVMSPPKVGDESYESYSAEKDGILSSLARRAKTLEDAFNNLEAVTCNKAEGAMYLFPCICLPEKAIKAAEAAKTA 418
225441981 340 QILASLVMSPPKVGDESYESYFMEKDGILSSLARRAKTLEDALNSLEGVTCNKAEGAMYLFPRIHLPEKAIKAAEAAKTA 419
242050886 399 QILASLVMNPPKAGDESFESFMLERDGILSSLARRAKALEEAFNSLEGITCNKAEGAMYLFPRLHLPQKAIGAAQAAGTA 478
297839097 393 QILASLVMSPPKPGDDSYDSYMAERDGILSSMAKRAKTLEDGLNSLEGVTCNRAEGAMYLFPRINLPQKAIEAAEAEKTA 472
297844672 400 QILASLIMSPPKPGDDSYESYIAEKDGILSSLARRAKTLEEALNKLEGVTCNRAEGAMYLFPCLHLPQKAIAAAEAEKTA 479
42562119  481 PDNFYCKRLLKATGIVVVPGSGFRQVPGTWHFRCTILPQEDKIPAIVDRLTAFHQSFMDEFRD 543
30698866  478 PDAFYCKRLLNATGVVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVNRLTEFHKSFMDEFRN 540
115481822 421 PDAFYALRLLEATGIVVVPGSGFGQVPGTWHIRCTILPQEEKIPAIISRFKAFHEGFMAAYRD 483
224119694 419 PDNFYCRCLLNATGIVFVPGSGFRQVPGTWHFRCTILPQEDKIPAVVSRLTEFHKSFMEEFRE 481
224074105 419 PDNFYCRRLLNATGIVFVPGSGFGQLPGTWHFRCTILPQEDKIPAVVSRLTEFHKSFMDEFRD 481
225441981 420 PDAFYARRLLNATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAVVSRLTEFHKGFMEEFRD 482
242050886 479 PDAYYAKRLLEATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIISRFKEFHEKFMDEFRD 541
297839097 473 PDAFYCKRLLNATGVVVVPGSGFGQAPGTWHFRCTILPQEDKIPAIVNRLTEFHKSFMDEFRD 535
297844672 480 PDNFYCKRLLKATGIVVVPGSGFRQVPGTWHFRCTILPQEDKIPAIVDRLTAFHKSFMDEFRD 542
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap