Conserved Protein Domain Family
PLN02230

?
PLN02230: PLN02230 
phosphoinositide phospholipase C 4
Statistics
?
PSSM-Id: 177875
View PSSM: PLN02230
Aligned: 2 rows
Threshold Bit Score: 1219.94
Threshold Setting Gi: 30697116
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
297796803   1 MEGKREMGSYKFCLIFTRKFRMTESGPVADVRELFEKYADGEAHMSPEQLQKLMAEEgGGGGETSLEEAERIVDEVLRRR 80 
30697116    1 MEGKKEMGSYKFCLIFTRKFRMTESGPVEDVRDLFEKYTEGDAHMSPEQLQKLMTEE-GGEGETSLEEAERIVDEVLRRK 79 
297796803  81 HHIAKFTRRNLTLDDFNYYLFSTDLNPPIGDQVHQNMDAPLSHYFIYTGHNSYLTGNQLSSNCSELPIADALRRGVRVVE 160
30697116   80 HHIAKFTRRNLTLDDFNYYLFSTDLNPPIADQVHQNMDAPLSHYFIFTGHNSYLTGNQLSSNCSELPIADALRRGVRVVE 159
297796803 161 LDLWPRGTDDVCVKHGRTLTKEVKLGKCLDSIKANAFVTSKYPVIITLEDHLTPKLQFKVAKMITQTFGDMLYYHDSESC 240
30697116  160 LDLWPRGTDDVCVKHGRTLTKEVKLGKCLESIKANAFAISKYPVIITLEDHLTPKLQFKVAKMITQTFGDMLYYHDSQGC 239
297796803 241 QEFPSPEELKEKILISTKPPKEYLEANDAKEKDSGEKGKDSDEDVWGKEPEDLISTQSDLEKVTSSVNDLSQDEEERGSC 320
30697116  240 QEFPSPEELKEKILISTKPPKEYLEANDTKEKDNGEKGKDSDEDVWGKEPEDLISTQSDLDKVTSSVNDLNQDDEERGSC 319
297796803 321 ESDTSCQLQAPEYKRLIAIHAGKPKGGLRMALKVDPNKIRRLSLSEQLLEKAVASYGADVIRFTRKNFLRIYPKGTRFNS 400
30697116  320 ESDTSCQLQAPEYKRLIAIHAGKPKGGLRMALKVDPNKIRRLSLSEQLLEKAVASYGADVIRFTQKNFLRIYPKGTRFNS 399
297796803 401 SNYKPQIGWMSGAQMIAFNMQGYGRALWLMEGMFRANGGCGYVKKPDFLMDAGSNGQGFYPKDNSCPKKTLKVKVLMGDG 480
30697116  400 SNYKPQIGWMSGAQMIAFNMQGYGRALWLMEGMFRANGGCGYVKKPDFLMDASPNGQDFYPKDNSSPKKTLKVKVCMGDG 479
297796803 481 WLLDFKKTHFDSYSPPDFFVRVGIAGAPVDEVMEKTKIEYDTWTPIWNKEFIFPLAVPELALLRVEVHEHDINEKDDFGG 560
30697116  480 WLLDFKKTHFDSYSPPDFFVRVGIAGAPVDEVMEKTKIEYDTWTPIWNKEFTFPLAVPELALLRVEVHEHDVNEKDDFGG 559
297796803 561 QTCLPVSEIRQGIHAVPLFNRKGVKYSSTRLLMRFEFV 598
30697116  560 QTCLPVSEIRQGIRAVPLFNRKGVKYSSTRLLMRFEFV 597
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap