Conserved Protein Domain Family
PLN02229

?
PLN02229: PLN02229 
alpha-galactosidase
Statistics
?
PSSM-Id: 177874
View PSSM: PLN02229
Aligned: 6 rows
Threshold Bit Score: 815.326
Threshold Setting Gi: 42572703
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
22331822    6 KMKDSVLFLVVGLFSLSVLVSQSIAGRVKAPLLQSntgglVFSKSFNSIYDTSMYGRLQLNNGLARTPQMGWNSWNFFAC 85 
42572703    6 KMKDSVLFLVVGLFSLSVLVSQSIAGRVKAPLLQSntgglVFSKSFNSIYDTSMYGRLQLNNGLARTPQMGWNSWNFFAC 85 
115474081   1 -MEAPRLRLPFLLLVALVVSPPAVAAAASRMRIEP-----LPTAALRRLYDTSNYGKLQLNNGLALTPQMGWNSWNFFAC 74 
242046940   6 RLPISLLVVSALLLLLSAQGPAGAAAAAVPPRIQP-----LATAALRRLYDTSNYGRLQLNNGLALTPQMGWNSWNFFAC 80 
225448651   1 MVKGSVHLLLFLYLSAISVGIAGRVVPLHEPFDKS-----TSSRSFSSIFDNSKYGILQLNNGLARTPQMGWNSWNFFAC 75 
297816956   1 -MKDSVLFL-VGLFSLSVLVSQSISGRVKAPLLQSntgglVFSKSFNSIYDTSMYGRLQLNNGLARTPQMGWNSWNFFAC 78 
22331822   86 NINETVIKETADALVSSGLADLGYIHVNIddcwsnllrdsegqlvphpetfpsGIKLLADYVHSKGLKLGIYSDAGVFTC 165
42572703   86 NINETVIKETADALVSSGLADLGYIHVNI------------------------GIKLLADYVHSKGLKLGIYSDAGVFTC 141
115474081  75 NINETVIRDTADALVSTGLADLGYNYVNIddcwsnvkrgkkdqllpdpktfpsGIKDLADYVHGKGLKLGIYSDAGIFTC 154
242046940  81 NINETVIRETADALVSTGLAALGYNFVNIddcwsyvkrgkqdqllpdpktfpsGIKALADYVHGKGLKLGIYSDAGKFTC 160
225448651  76 NINETVIKETADALVSTGLADLGYVYVNIddcwsslerdskgqlvpdpktfpsGIKALADYVHAKGLKLGIYSDAGIFTC 155
297816956  79 NINETVIKETADALLSSGLADLGYIHVNIddcwsnllrdskgqlvphpetfpsGIKLLADYVHSKGLKLGIYSDAGVFTC 158
22331822  166 EVHPGSLFHEVDDADIFASWGVDYLKYDNCFNLGIKPIERYPPMRDALNATGRSIFYSLCEWGVDDPALWAKEVGNSWRT 245
42572703  142 EVHPGSLFHEVDDADIFASWGVDYLKYDNCFNLGIKPIERYPPMRDALNATGRSIFYSLCEWGVDDPALWAKEVGNSWRT 221
115474081 155 QVRPGSLHHEKDDAAIFASWGVDYLKYDNCYNLGIKPKDRYPPMRDALNSTGRQIFYSLCEWGQDDPALWAGKVGNSWRT 234
242046940 161 QVRPGSLDHESDDAAIFASWGVDYLKYDNCYNLGIKPQKRYPPMRDALNSTGRQIFYSLCEWGQDDPALWAGKVGNSWRT 240
225448651 156 QVRPGSIYHERDDAELFASWGVDYLKYDNCYNLGIKPEERYPPMRNALNATGRTIFYSLCEWGVDDPALWAGKVGNSWRT 235
297816956 159 QVRPGSLFHEVDDADIFASWGVDYLKYDNCFNLGIKPIKRYPPMRDALNATGRSIFYSLCEWGVDDPALWAKEVGNSWRT 238
22331822  246 TDDINDTWASMTTIADLNNKWAAYAGPGGWNDPDMLEIGNGGMTYEEYRGHFSIWALMKAPLLIGCDVRNMTAETLEILS 325
42572703  222 TDDINDTWASMTTIADLNNKWAAYAGPGGWNDPDMLEIGNGGMTYEEYRGHFSIWALMKAPLLIGCDVRNMTAETLEILS 301
115474081 235 TDDIQDTWKSMTDIADKNNKWASYAGPGGWNDPDMLEVGNGGMTFAEYRAHFSIWALMKAPLLIGCDVRNMTKETMEILS 314
242046940 241 TDDITDTWQSMTDIADKNNKWASYAGPGGWNDPDMLEVGNGGMTSAEYRSHFSIWALMKAPLLIGCDVRNMTSETMEILS 320
225448651 236 TDDINDSWASMTTIADLNDEWAAYAGPGGWNDPDMLEVGNGGMTLEEYRAHFSIWALMKAPLLVGCDVRNITAETFEIIG 315
297816956 239 TDDINDTWASMTTIADLNNKWAAYAGPGGWNDPDMLEIGNGGMTYEEYRGHFSIWALMKAPLLIGCDVRNMTAETFEILS 318
22331822  326 NKEIIAVNQDPLGVQGRKIQANGENDCQQVWSGPLSGDRMVVALWNRCSEPATITASWDMIGLESTISVSVRDLWQHKDV 405
42572703  302 NKEIIAVNQDPLGVQGRKIQANGENDCQQVWSGPLSGDRMVVALWNRCSEPATITASWDMIGLESTISVSVRDLWQHKDV 381
115474081 315 NKEVIQVNQDPLGVQGRRILGQGKNGCQEVWAGPLSGNRLAVVLWNRCEESANIIVKLPSVGLDGSSPYSVRDLWKHETL 394
242046940 321 NKEVIQVNQDPLGVQGRKILGEGKYGCREVWAGPLSGNRLVIALWNRCSETANITMKLPAVGLDGSAAYSVRDLWKHETL 400
225448651 316 NKEVIDINQDSLGIQGRKVHVSGKDGCRQVWAGPLSGHRLVVALWNRCSKAATITVGWEVLGLESSMSVSIRDLWKHVDL 395
297816956 319 NKEVIAVNQDPLGVQGRKIQANGEDDCQQVWSGPLSGDRIVVALWNRCSEQATITASWDVIGLESTISVSVRDLWQHKDV 398
22331822  406 TENTSGSFEAQVDAHDCHMYVLTPQTVSHSDV 437
42572703  382 TENTSGSFEAQVDAHDCHMYVLTPQTVSHSDV 413
115474081 395 SENVVGTFGAQVDVHDCKMYIFTPAVTVASS- 425
242046940 401 SENVVGTFGAQVDVHDTKMYIFSPATSVASI- 431
225448651 396 SGDAVASFGSLVASHDCGMYIFTPVSASRSAV 427
297816956 399 TENASGSFEAQVDAHDCHMYVLTPQTVSHSDV 430
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap