Conserved Protein Domain Family
PLN02228

?
PLN02228: PLN02228 
Phosphoinositide phospholipase C
Statistics
?
PSSM-Id: 177873
View PSSM: PLN02228
Aligned: 4 rows
Threshold Bit Score: 1151.32
Threshold Setting Gi: 297796797
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
297797842   1 MSESFKVCFCCSRSFKEKTREPPVSIKRLFEAYSRNGKMSFDELLRFVSEVQGERHAGLDYVQDIFHSVKHHNIFHHHGL 80 
79499922    1 MSESFKVCFCCSRSFKEKTRQPPVSIKRLFEAYSRNGKMSFDELLRFVSEVQGERHAGLDYVQDIFHSVKHHNVFHHHGL 80 
18424132    1 MKESFKVCFCCVRNFKVKSSEPPEEIKNLFHDYSQDDRMSADEMLRFVIQVQGETHADINYVKDIFHRLKHHGVFHPRG- 79 
297796797   1 MKESFKVCFCCVRSFKVKSSEPPEEIKNLFHDYSQDDRMSADEMLRFVIQVQGETHADINYVKDIFHRLKHHGVFHPRG- 79 
297797842  81 VHLNAFYRYLFSDTNSPLPMSGQVHHDMKAPLSHYFVYTGHNSYLTGNQVNSRSSVEPIVQALRKGVKVIELDLWPNPSG 160
79499922   81 VHLNAFYRYLFSDTNSPLPMSGQVHHDMKAPLSHYFVYTGHNSYLTGNQVNSRSSVEPIVQALRKGVKVIELDLWPNPSG 160
18424132   80 IHLEGFYRYLLSDFNSPLPLTREVWQDMNQPLSHYFLYTGHNSYLTGNQLNSNSSIEPIVKALRNGVRVIELDLWPNSSG 159
297796797  80 IHLEGFYRYLLSDFNSPLPVTSEVWQDMNQPLSHYFLYTGHNSYLTGNQLNSNSSIEPIVKALRKGVRVIELDLWPNSSG 159
297797842 161 NAAEVRHGRTLTSHEDLQKCLNAIKDNAFYVSDYPVMITLEDHLPPNLQAQVARMLTKTFRGMLFRCGSESWKHFPSPEE 240
79499922  161 NAAEVRHGRTLTSHEDLQKCLTAIKDNAFHVSDYPVIITLEDHLPPKLQAQVAKMLTKTYRGMLFRRVSESFKHFPSPEE 240
18424132  160 KEAEVRHGGTLTSREDLQKCLNVVKENAFQVSAYPVVLTLEDHLTPILQKKVAKMVSKTFGGSLFQCTDETTECFPSPES 239
297796797 160 KEAEVRHGGTLTSCEDLQKCLNAVKENAFQVSAYPVVLTLEDHLTPNLQKKVAKMVSKTFGGSLFQCTDEYTECFPSPES 239
297797842 241 LKKKILISTKPPKEYLESKTVQTTRTPMVKETSWSRVAsstnmarggeNKILEEKGELESEAVgGYRDLIAIHAANCKDP 320
79499922  241 LKGKILISTKPPKEYLESKTVHTTRTPTVKETSWNRVA----------NKILEEYKDMESEAV-GYRDLIAIHAANCKDP 309
18424132  240 LKNKILISTKPPKEYLQTQISKGSTTD--ESTRAKKISda-------eEQVQEE--DEESVAI-EYRDLISIHAGNRKGG 307
297796797 240 LKNKILISTKPPKEYLQTQVSQGSTTD--ESIKAKKIAda-------eEQVQEE--DEESVAI-EYRDLISIHAGNRKGG 307
297797842 321 LKDCLSDDPEKPRRVSMDEQWLETMVRTRGTDLVRFTQRNLVRIYPKGTRVDSSNYDPHVGWTHGAQMVAFNMQGHGKQL 400
79499922  310 SKDCLSDDPEKPIRVSMDEQWLDTMVRTRGTDLVRFTQRNLVRIYPKGTRVDSSNYDPHVGWTHGAQMVAFNMQGHGKQL 389
18424132  308 LKNCLNGDPNRVIRLSMSEQWLETLAKTRGPDLVKFTQRNLLRIFPKTTRFDSSNYDPLVGWIHGAQMVAFNMQSHGRYL 387
297796797 308 LKNCLNGDPNRVIRLSMSEQWLETLAKTRGSDLVKFTQRNLLRIFPKTTRFDSSNYDPLVGWIHGAQMVAFNMQSHGRYL 387
297797842 401 WIMQGMFRANGGCGYVKKPRILLD---EHTLFDPC-KRLPIKTTLKVKVYTGEGWDLDFHQTHFDQYSPPDFFVK--IGI 474
79499922  390 WIMQGMFRGNGGCGYVKKPRILLD---EHTLFDPC-KRFPIKTTLKVKIYTGEGWDLDFHHTHFDQYSPPDFFVK--IGI 463
18424132  388 WMMQGMFKANGGCGYVKKPDVLLSngpEGEIFDPCsQNLPIKTTLKVKIYTGEGWNMDFPLDHFDRYSPPDFYAK--VGI 465
297796797 388 WMMQGMFKANGGCGYVKKPDVLLSngpGGEIFDPCsQKLPIKTTLKVKIYTGEGWNMDFPLDHFDRYSPPDFYAKarVGI 467
297797842 475 AGVPRDTVSYRTETAVDQWFPIWSNDEFLFQLCVPELALLWFKVQDYDNDTQNDFAGQTCLPLPELKSGVRAVRLHDRAG 554
79499922  464 AGVPRDTVSYRTETAVDQWFPIWGNDEFLFQLSVPELALLWFKVQDYDNDTQNDFAGQTCLPLPELKSGVRAVRLHDRTG 543
18424132  466 AGVPLDTASYRTEIDKDEWFPIW-DKEFEFPLRVPELSLLCITVKDYDSNTQNDFAGQTCFPLSEVRPGIRAVRLHDRAG 544
297796797 468 AGVPLDTASYRTEIDTDEWFPIW-DKEFEFPLRVPELAILCITVKDYDSNTQNDFAGQTCLPLSEVRPGIRAVRLHDRAG 546
297797842 555 KAYKNTRLLVSFALDPPYTFR 575
79499922  544 KAYKNTRLLVSFALDPPYTFR 564
18424132  545 EVYKHVRLLMRFVLEPR---- 561
297796797 547 EVYKHVRLLMRFVLEPR---- 563
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap