Conserved Protein Domain Family
PLN02226

?
PLN02226: PLN02226 
2-oxoglutarate dehydrogenase E2 component
Statistics
?
PSSM-Id: 177871
View PSSM: PLN02226
Aligned: 5 rows
Threshold Bit Score: 812.834
Threshold Setting Gi: 297792977
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
18416889    1 MMMRAVIRRAASNGSSPSL-FAKSLQSSRVAASSpSLLSGSETGAYLHRGNHAHSFHNLALPaGNSGISRSA--SLVSST 77 
15240454    1 MMLRAVFRRASIRGSSSASgLGKSLQSSRVAVSA-QFHSVSATETLVPRGNHAHSFHHRSCP-GCPDCSRTIinGYQGTA 78 
30687405    1 MMMRAVIRRAASNGSSPSL-FAKSLQSSRVAASSpSLLSGSETGAYLHRGNHAHSFHNLALP-GNSGISRSA--SLVSST 76 
297799302   1 MMLRAVIRRATTKGSSPSL-FGKSLQSSRVAASSpSLLTGSETGAFLHCGNHARSFHNLALPaGNSGISRSA--SLVSST 77 
297792977   1 MMLRALIRRASTRGSSSASgLGKSLQSSRVVASA-QFHSVSATETLVPRGNHSRSFHHRSCP-GCPDCSRTVfnGYQGTA 78 
18416889   78 LQRWVRPFSAETGDTVEAVVPHMGESITDGTLATFLKKPGERVQADEAIAQIETDKVTIDIASPASGVIQEFLVNEGDTV 157
15240454   79 LQRWVRPFSSDSGDVVEAVVPHMGESITDGTLAAFLKKPGDRVEADEAIAQIETDKVTIDIASPASGVIQEFLVKEGDTV 158
30687405   77 LQRWVRPFSAETGDTVEAVVPHMGESITDGTLATFLKKPGERVQADEAIAQIETDKVTIDIASPASGVIQEFLVNEGDTV 156
297799302  78 LQRWVRPFSSESGDTVEAVVPHMGESITDGTLATFLKKPGERVQADEAIAQIETDKVTIDIASPASGVIQEFLVKEGDTV 157
297792977  79 LQRWARPFSSDSGDVVEAVVPHMGESITDGTLATFLKKPGDRVEADETIAQIETDKVTIDIASPASGVIQEFLVKEGDTV 158
18416889  158 EPGTKVAIISKSEDTASQVTPSQKIPETTDTKPSPPAEdkqKPRVESAPVAEKPKAPSSPPPP--KQSAKEPQLPPKERE 235
15240454  159 EPGNKVARISTSADAVSHVAPSEKAPEKPAPKPSPPAE---KPKVESTKVAEKPKAPSPPPPPpsKQSAKEPQLPPKDRE 235
30687405  157 EPGTKVAIISKSEDTASQVTPSQKIPETTDTKPSPPAEdkqKPRVESAPVAEKPKAPSSPPPP--KQSAKEPQLPPKERE 234
297799302 158 EPGTKVAIISKSEDAASQATPSQKIPETTDSKPSPPAEdkqKPKVESAPVAEKPKAPSSPPPP--KQSAKEPQLPPKERE 235
297792977 159 EPGNKVARISTSADAVSHVAPSEKTPEKPAPKPSPPAE---KPKVESTKVAEKPKAPSPPPPPp-KQSAKEPQLPPKDRE 234
18416889  236 RRVPMTRLRKRVATRLKDSQNTFALLTTFNEVDMTNLMKLRSQYKDAFYEKHGVKLGLMSGFIKAAVSALQHQPVVNAVI 315
15240454  236 RRVPMTRLRKRVATRLKDSQNTFALLTTFNEVDMTNLMKLRSQYKDAFLEKHGVKLGLMSGFIKAAVSALQHQPVVNAVI 315
30687405  235 RRVPMTRLRKRVATRLKDSQNTFALLTTFNEVDMTNLMKLRSQYKDAFYEKHGVKLGLMSGFIKAAVSALQHQPVVNAVI 314
297799302 236 RRVPMTRLRKRVATRLKDSQNTFALLTTFNEVDMTNLMKLRSQYKDAFYEKHGVKLGLMSGFIKAAVSALQHQPVVNAVI 315
297792977 235 RRVPMTRLRKRVATRLKDSQNTFALLTTFNEVDMTNLMKLRSQYKDAFFEKHGVKLGLMSGFIKAAVSALQYQPVVNAVI 314
18416889  316 DGDDIIYRDYVDISIAVGTSKGLVVPVIRGADKMNFAEIEKTINSLAKKANEGTISIDEMAGGSFTVSNGGVYGSLISTP 395
15240454  316 DGDDIIYRDYVDISIAVGTSKGLVVPVIRDADKMNFADIEKTINGLAKKATEGTISIDEMAGGSFTVSNGGVYGSLISTP 395
30687405  315 DGDDIIYRDYVDISIAVGTSKGLVVPVIRGADKMNFAEIEKTINSLAKKANEGTISIDEMAGGSFTVSNGGVYGSLISTP 394
297799302 316 DGDDIIYRDYVDISIAVGTSKGLVVPVIRGADKMNFAEIEKTINTLARKANEGTISIDEMAGGSFTVSNGGVYGSLISTP 395
297792977 315 DGDDIIYRDYVDISIAVGTSKGLVVPVIRDADKMNFADIEKTINGLAKKANEGTISIDEMAGGSFTVSNGGVYGSLISTP 394
18416889  396 IINPPQSAILGMHSIVSRPMVVGGSVVPRPMMYVALTYDHRLIDGREAVYFLRRVKDVVEDPQRLLLDI 464
15240454  396 IINPPQSAILGMHSIVQRPMVVGGSVVPRPMMYVALTYDHRLIDGREAVYFLRRIKDVVEDPQRLLLDI 464
30687405  395 IINPPQSAILGMHSIVSRPMVVGGSVVPRPMMYVALTYDHRLIDGREAVYFLRRVKDVVEDPQRLLLDI 463
297799302 396 IINPPQSAILGMHSIVSRPMVVGGSVVPRPMMYVALTYDHRLIDGREAVYFLRRVKDVVEDPQRLLLDI 464
297792977 395 IINPPQSAILGMHSIVQRPMVVGGSVVPRPMMYVALTYDHRLIDGREAVYFLRRIKDVVEDPQRLLLDI 463
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap