Conserved Protein Domain Family
PLN02225

?
PLN02225: PLN02225 
1-deoxy-D-xylulose-5-phosphate synthase
Statistics
?
PSSM-Id: 177870
View PSSM: PLN02225
Aligned: 2 rows
Threshold Bit Score: 1404.07
Threshold Setting Gi: 15239030
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
297807177   1 MGSASIGYQIGISARFYGNFNLSSDVTVSSLPCKVDVSIKSLFSAPSSTHKECSNRARVcCSLPNTDEYCDEKFETPILD 80 
15239030    1 MGSASIGYQFGISARFYGNFNLSSDITVSSLPCKLDVSIKSLFSAPSSTHKEYSNRARV-CSLPNTDGYCDEKFETPILD 79 
297807177  81 TIETPLQLKNLSVKELKLLADEIRTELHSVLWKKTQKSMNPSFAAIELTLALHYVFRAPVDNILWDAVEQTYAHKVLTRR 160
15239030   80 SIETPLQLKNLSVKELKLLADEIRTELHSVLWKKTQKSMNPSFAAIELTLALHYVFRAPVDNILWDAVEQTYAHKVLTRR 159
297807177 161 WSAIPSRQKNGTSGVTSQLESEYDSFGTGHGCNSTSAGLGLAVARDIKGKRDRVVAVIDNATITAGQAYEAMSNAGYLDS 240
15239030  160 WSAIPSRQNSGISGVTSRLESEYDSFGTGHGCNSISAGLGLAVARDMKGKRDRVVAVIDNVTITAGQAYEAMSNAGYLDS 239
297807177 241 NMIVILNDSRHSLHPNMEEGSKASISALSSIMSKIQSSKIFRKFRELAKSMTKRIGKGMYEWAAKVDEYARGMVGPTGST 320
15239030  240 NMIVILNDSRHSLHPNMEEGSKASISALSSIMSKIQSSKVFRKFRELAKAMTKRIGKGMYEWAAKVDEYARGMVGPTGST 319
297807177 321 LFEELGLYYIGPVDGHNIEDLVCVLREVSSLDSMGPVLVHVITEENRDAETGKNIMVKDRRTYSDCFVEALVMEAEKDRD 400
15239030  320 LFEELGLYYIGPVDGHNIEDLVCVLREVSSLDSMGPVLVHVITEGNRDAETVKNIMVKDRRTYSDCFVEALVMEAEKDRD 399
297807177 401 IVVVHAGMEMDASLITFQERFPDRFFNVGMAEQHAVTFSAGLSSGGLKPFCIIPSAFLQRAYDQVVHDVDRQRKAVRFVI 480
15239030  400 IVVVHAGMEMDPSLLTFQERFPDRFFNVGMAEQHAVTFSAGLSSGGLKPFCIIPSAFLQRAYDQVVHDVDRQRKAVRFVI 479
297807177 481 TSAGLVGSDGPVQCGAFDIAFMSSLPNMIAMAPADEDELVNMVATAAYVTDRPVCFRFPRGSIVNRNYLVPTGLPIEIGR 560
15239030  480 TSAGLVGSDGPVQCGAFDIAFMSSLPNMIAMAPADEDELVNMVATAAYVTDRPVCFRFPRGSIVNMNYLVPTGLPIEIGR 559
297807177 561 GRVLVEGQDVALLGYGAMVQNCLHAHSLLSKLGLNVTVADARFCKPLDIKLVRDLCQNHKILITVEEGCVGGFGSHVAQF 640
15239030  560 GRVLVEGQDVALLGYGAMVQNCLHAHSLLSKLGLNVTVADARFCKPLDIKLVRDLCQNHKFLITVEEGCVGGFGSHVAQF 639
297807177 641 IALDGQLDGNIKWRPIVLPDGYIEEASPREQLALAGLTGHHIAATALSLLGRTREALLLMS 701
15239030  640 IALDGQLDGNIKWRPIVLPDGYIEEASPREQLALAGLTGHHIAATALSLLGRTREALLLMS 700
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap