Conserved Protein Domain Family
PLN02224

?
PLN02224: PLN02224 
methionine-tRNA ligase
Statistics
?
PSSM-Id: 177869
View PSSM: PLN02224
Aligned: 2 rows
Threshold Bit Score: 1267.33
Threshold Setting Gi: 297820298
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15233258    1 MAARINTSLHNALSFLKPFNTPLNTKPFSfRRNSFRFSKKLPYYSQFSSGKRALYCTSSSQESTVDEGETFVLTTPLYYV 80 
297820298   1 MAARINTSLHNALSLLNAFNTPLNYKPFT-CRNCFRFSKKLPYYSQSSSGKRALYCTYSSQESTVDGADTFVLTTPLYYV 79 
15233258   81 NAPPHMGSAYTTIAADSIARFQRLLGKKVIFITGTDEHGEKIATSAAANGRNPPEHCDLISQSYRTLWKDLDIAYDKFIR 160
297820298  80 NAPPHMGSAYTTIAADSIARFQRLLGKKVIFITGTDEHGEKIATSAAANGRNPPEHCDIISQSYRTLWKDLDIAYDKFIR 159
15233258  161 TTDPKHEAIVKEFYARVFANGDIYRADYEGLYCVNCEEYKDEKELLENNCCPVHQMPCVARKEDNYFFALSKYQKPLEDI 240
297820298 160 TTDPKHEAIVKEFYARVFANGDIYRADYEGLYCVNCEEYKDEKELLENNCCPVHQMPCVARKEDNYFFALSKYQKPLEDI 239
15233258  241 LAQNPRFVQPSYRLNEVQSWIKSGLRDFSISRALVDWGIPVPDDDKQTIYVWFDALLGYISALTEDNKQQNLETAVSFGW 320
297820298 240 LAQNPRFVQPSYRLNEVQSWIKSGLRDFSISRALVDWGIPVPDDDKQTIYVWFDALLGYISALTEDNKQQNLETAVSLGW 319
15233258  321 PASLHLIGKDILRFHAVYWPAMLMSAGLELPKMVFGHGFLTKDGMKMGKSLGNTLEPFELVQKFGPDAVRYFFLREVEFG 400
297820298 320 PASLHLIGKDILRFHAVYWPAMLMSAGLNLPKMVFGHGFLTKDGMKMGKSLGNTLEPFELVQKFGPDAVRYFFLREVEFG 399
15233258  401 NDGDYSEDRFIKIVNAHLANTIGNLLNRTLGLLKKNCESTLVVDSTVAAEGVPLKDTVEKLVEKARTNYENLSLSSACEA 480
297820298 400 NDGDYSEDRFIKIVNAHLANTIGNLLNRTLGLLKKNCESTLVEDSTVAAEGVPLKDTVEKLVEKAQTNYENLSLSSACEA 479
15233258  481 VLEIGNAGNTYMDQRAPWFLFKQGGVSAEEAAKDLVIILEVMRVIAVALSPVAPCLSLRIYSQLGYTEDQFNSITWSDTK 560
297820298 480 VLEIGNAGNTYMDQRAPWFLFKQGGVSAEEAAKDLVIILEVMRVIAVALSPIAPCLSLRIYSQLGYSVDQFNSITWSDTK 559
15233258  561 WGGLKGGQVMEQASPVFARIELNPEKEEDEKKPKVGKKTGKAKVKVVEQTPTVAEA 616
297820298 560 WGGLKGGQVMEQASPVFARIELNPEKEEEEKKPKVGKKTGKVKVKVVEQTPTVAEA 615
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap