Conserved Protein Domain Family
PLN02223

?
PLN02223: PLN02223 
phosphoinositide phospholipase C
Statistics
?
PSSM-Id: 165867
View PSSM: PLN02223
Aligned: 2 rows
Threshold Bit Score: 1170.18
Threshold Setting Gi: 42565683
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15232770   1 MLVTRRWESHPANSPDLILQFFGNEFHGYGDDMPETLRRLTELLGYEKEEDGAGMNAAKKIAAELNRRKDDIPAFRRLRC 80 
42565683   2 VNLRKKFEMKQANQPGRVPNYFRNKYHGYDDDMPNLLPTFIKLLDTEKDEDGAGLNAAEQIDRELKSRKCDILKFRNLTI 81 
15232770  81 LELDQLNEFLFSTKLNPPIGDQV-HHDMHAPLSHYFIHTSLNSYFTG-NVFGK-YSILPIIEALEQGVRVVELDLWPDGR 157
42565683  82 LELPHLNEFLFSTELNPPISDQVrHRDMNAPLSHYFIHTSLKSYFTGnNVFGRlYSIEPIIDALKQGVRVVELDLLPFGK 161
15232770 158 GSICVRPSWNFEKPLKLQECLDSIKEHAFTKC-TYPLIITFKDGLKPELQSKATQMIQQTFNHMVYHHDP-HSLEVFPSP 235
42565683 162 DGICVRPKWNFEKPLELQECLDAIKQHAFTPTrSYPVIITIKDSLKPDLQSKVTQMIDQTFGDMVYHEDPqQSLEEFPSP 241
15232770 236 QQLRNKILISRRPPKELLYANDDDGKVgvrnGVEIRQHPADPNYQSLVSFHVVEPRGMLQNVLTgkaNKIQRPGWYETDI 315
42565683 242 AELQNKILISRRPPTKLLYAKAVENGV----ELEIQEGSTDKNYQSVVGFHAVEPRGMLQKALT---DDVQQPGWYERDV 314
15232770 316 ISFTQKRFLRTRPQRK-LLIYAPYKPQRAWMHGAQLIALSRKEEKEKLWLMQGMFRANGGCGYVKKPDFLLNAGPSGVFY 394
42565683 315 ISFTQNKFLRTRPKKRnLLSNPPYKPQRAWMHGAQMIALSRQDDKEKLWLMQGMFRANGGCGYVKKPNFLLNAGSSGVFY 394
15232770 395 PTVNPVVVKILKVKIYMGDGWIVDFKKRIGRLSKPDLYVRISIAGVPHDENIMKTTVKNNEWTPTWGEEFTFPLTYPDLA 474
42565683 395 PTENPVVVKTLKVKIYMGDGWIVDFKKRIGRLSKPDLYVRISIAGVPHDEKIMNTTVKNNEWKPTWGEEFTFPLTYPDLA 474
15232770 475 LISFEVYDYEVSTADAFCGQTCLPVSELIEGIRAVPLYDERGKACSSTMLLTRFKWS 531
42565683 475 LISFEVYDYEVSTPDYFCGQTCLPVSELIEGIRAVPLYDERGKACSSTMLLTRFKWS 531
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap