Conserved Protein Domain Family
PLN02222

?
PLN02222: PLN02222 
phosphoinositide phospholipase C 2
Statistics
?
PSSM-Id: 177868
View PSSM: PLN02222
Aligned: 5 rows
Threshold Bit Score: 1191.37
Threshold Setting Gi: 15228780
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
297816920   1 MSKQTYKVCFCFRRRYRHTVSVAPPEIKTLFDKYSDKGLMTTDLLLRFLIDVQKQDKATKEEAQEIVNASSSLLHRNGLH 80 
15231929    1 MSKQTYKVCFCFRRRFRYTASEAPREIKTIFEKYSENGVMTVDHLHRFLIDVQKQDKATREDAQSIINSASSLLHRNGLH 80 
15228780    1 MSKQTYKVCFCFRRRYRHTVSVAPAEIKTLFDNYSDKGLMTTDLLLRFLIDVQKQDKATKEEAQDIVNASSSLLHRNGLH 80 
79313161    1 MSKQTYKVCFCFRRRFRYTASEAPREIKTIFEKYSENGVMTVDHLHRFLIDVQKQDKATREDAQSIINSASSLLHRNGLH 80 
297833600   1 MSKQTYKVCFCFRRRFRYTASEAPRDIKTIFEKYSENGVMTVDHLHRFLIDVQKQDKATREDAQSIINSASSLLHRNGLH 80 
297816920  81 LDAFFKYLFAVTNSPLSSQEVHQDMDAPLSHYFIFTGHNSYLTGNQLSSDCSELPIIEALKKGVRVIELDIWPNSDEDGI 160
15231929   81 LDAFFKYLFGDNNPPLALHKVHHDMDAPISHYFIFTGHNSYLTGNQLSSDCSEVPIIDALKKGVRVIELDIWPNSNKDDI 160
15228780   81 LDAFFKYLFAVTNSPLSSLEVHQDMDAPLSHYFIYTGHNSYLTGNQLSSDCSELPIIEALKKGVRVIELDIWPNSDEDGI 160
79313161   81 LDAFFKYLFGDNNPPLALHKVHHDMDAPISHYFIFTGHNSYLTGNQLSSDCSEVPIIDALKKGVRVIELDIWPNSNKDDI 160
297833600  81 LDAFFKYLFGDNNPPLALHEVHHDMDAPISHYFIFTGHNSYLTGNQLSSDCSEVPIIDALKKGVRVIELDIWPNSKKDDI 160
297816920 161 DVLHGRTLTSPVELIKCLRAIREHAFDVSDYPVVVTLEDHLTPKLQAKVAEMVTDIFGEMLFTPPSGECLKEFPSPAFLK 240
15231929  161 DVLHGMTLTTPVGLIKCLKAIRAHAFDVSDYPVVVTLEDHLTPDLQSKVAEMVTEIFGEILFTPPVGESLKEFPSPNSLK 240
15228780  161 DVLHGRTLTSPVELIKCLRAIREHAFDVSDYPVVVTLEDHLTPKLQAKVAEMVTDIFGEMLFTPPSGECLKEFPSPAFLK 240
79313161  161 DVLHGMTLTTPVGLIKCLKAIRAHAFDVSDYPVVVTLEDHLTPDLQSKVAEMVTEIFGEILFTPPVGESLKEFPSPNSLK 240
297833600 161 DVLHGMTLTTPVGLIKCLKAIRAHAFDVSDYPVVVTLEDHLTPDLQSKVAEMVTEIFGEILFTPPVGESLKEFPSPNSLK 240
297816920 241 NRIMISTKPPKEYKAATDDDLVKKCRNLGDEEVWGREVPSFIRRDRSVDKNDSNGdddddddDDDDDDDDGDDKIKKNAP 320
15231929  241 RRIIISTKPPKEYKEGKDVEVVQKGKDLGDEEVWGREVPSFIQRNKSEAKDDLDG-------NDDDDDDDDEDKSKINAP 313
15228780  241 KRIMISTKPPKEYKAATDDDLVKKGRDLGDKEVWGREVPSFIRRDRSVDKNDSNGddd-dddDDDDDDDDGDDKIKKNAP 319
79313161  241 RRIIISTKPPKEYKEGKDVEVVQKGKDLGDEEVWGREVPSFIQRNKSEAKDDLDG-------NDDDDDDDDEDKSKINAP 313
297833600 241 KRIIISTKPPKKYKEGKDEEVVQKGKSLGDEEVWGREVPSFIQRNKS------------------------EAKSKNNAP 296
297816920 321 PEYKHLIAIEAGKPKGGITECLKVDPDKVRRLSLSEEQLEKASEKYAKQIVRFTQRNLLRVYPKGTRITSSNYNPLIAWS 400
15231929  314 PQYKHLIAIHAGKPKGGITECLKVDPDKVRRLSLSEEQLEKAAEKYAKQIVRFTQHNLLRIYPKGTRVTSSNYNPLVGWS 393
15228780  320 PEYKHLIAIEAGKPKGGITECLKVDPDKVRRLSLSEEQLEKASEKYAKQIVRFTQRNLLRVYPKGTRITSSNYNPLIAWS 399
79313161  314 PQYKHLIAIHAGKPKGGITECLKVDPDKVRRLSLSEEQLEKAAEKYAKQIVRFTQHNLLRIYPKGTRVTSSNYNPLVGWS 393
297833600 297 PQYKHLIAIHAGKPKGGITECLKVDPDKVRRLSLSEEQLEKAAEKYAKQIVRFTQHNLLRIYPKGTRVTSSNYNPLVGWS 376
297816920 401 HGAQMVAFNMQGLGRSLWVMQGMFRGNGGCGYIKKPDLLLKSDA---VFDPEATLPVKTTLRVTIYMGEGWYYDFPHTHF 477
15231929  394 HGAQMVAFNMQGYGRSLWLMQGMFRANGGCGYIKKPDLLLKSGSdsdIFDPKATLPVKTTLRVTVYMGEGWYFDFRHTHF 473
15228780  400 HGAQMVAFNMQGLGRSLWVMQGMFRGNGGCGYIKKPDLLLKSNA---VFDPEATLPVKTTLRVTIYMGEGWYYDFPHTHF 476
79313161  394 HGAQMVAFNMQGYGRSLWLMQGMFRANGGCGYIKKPDLLLKSGSdsdIFDPKATLPVKTTLRVTVYMGEGWYFDFRHTHF 473
297833600 377 HGAQMVAFNMQGYGRSLWLMQGMFRANGGCGYIKKPDILLKSGSdseIFDPKVTLPVKTTLRVTIYMGEGWYFDFRHTHF 456
297816920 478 DRYSPPDFYTRVGIAGVPADTIMKKTKTLEDNWIPAWDEVFEFPLTVPELALLRIEVHEYDMSEKDDFGGQTCLPVWELR 557
15231929  474 DQYSPPDFYTRVGIAGVPGDTVMKKTKTLEDNWIPAWDEVFEFPLTVPELALLRLEVHEYDMSEKDDFGGQTCLPVWELS 553
15228780  477 DRYSPPDFYTRVGIAGVPADTVMKKTKTLEDNWIPAWDEVFEFPLTVPELALLRIEVHEYDMSEKDDFGGQICLPVWELR 556
79313161  474 DQYSPPDFYTRVGIAGVPGDTVMKKTKTLEDNWIPAWDEVFEFPLTVPELALLRLEVHEYDMSEKDDFGGQTCLPVWELS 553
297833600 457 DQYSPPDFYTRVGIAGVPGDTIMKKTKTLEDNWIPAWDEVFEFPLTVPELALLRLEVHEYDMSEKDDFGGQTCLPVWELS 536
297816920 558 QGIRAVPLRNQDGVKCRSVKLLLRLEFV 585
15231929  554 EGIRAFPLHSRKGEKYKSVKLLVKVEFV 581
15228780  557 QGIRAVPLRNQDGVKCRSVKLLVRLEFV 584
79313161  554 EGIRAFPLHSRKGEKYKSVKLLVKVEFV 581
297833600 537 GGIRSFPLHSRKGEKYKSVKLLVKVEFV 564
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap