Conserved Protein Domain Family
PLN02221

?
PLN02221: PLN02221 
asparaginyl-tRNA synthetase
Statistics
?
PSSM-Id: 177867
View PSSM: PLN02221
Aligned: 4 rows
Threshold Bit Score: 1207.13
Threshold Setting Gi: 224122518
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15241897    1 MADEIVPPATQLAAVSLENDGSTVQRAQFSNRVLIRTILdrpDGGAGLAGQTVRIGGWVKSGRDQGKRTFSFLAVNDGSC 80 
15223302    1 MGDEIVPPANQLAADNLENDGSTVQKAQFSDRVLIRSIL---GGGAKLAGQKVRIGGWVKTGRQQGKGTFAFLEVNDGSC 77 
224122518   1 MGDPATPPASELAAMAIIDGASL--KHPFSDRVPVRSIVcrpDGGAGLAGNRVRAGGWVKTGREQGKGSFAFLEVNDGSC 78 
297793179   1 MADEIAPPANQLAAVSLGNDGSTVQKAQFSNRVLIRTILdrpDGGAKLAGQKIRIGGWVKTGREQGKGAFAFLEVNDGSC 80 
15241897   81 PANLQVMVDPSLYDVSNLVATGTCVTVDGVLKVPPKGKGTQQQIELNVVKVIDVGTVDASKYPLPKTKLTLETLRDVLHL 160
15223302   78 PANLQVMVDSSLYDLSRLVATGTCVTVDGVLKIPPEGKGLKQSIELSVETVIAVGTVDPTTYPLPKTKLTPEFLRDVLHL 157
224122518  79 PANLQVIVDAGVEDLSTLVQTGTCVSVEGVLKVPPE--GTKQKIELRVERVLHVGPTDPAKYPIPKTKLSLEFLRDHIHL 156
297793179  81 PANLQVMVDSSLYDLSKLVATGTCVTVDGVLKVPPEGKGTKQRIELSVVKVIDVGIVDATKYPLPKTKLTLEFLRDVLHL 160
15241897  161 RSRTNSISAVARIRNALAFATHSFFQEHSFLYIHTPIITTSDCEGAGEMFQATTLINYTERLEQDLIDNPPPTEADVEAA 240
15223302  158 RSRTNLISAVARIRNALAFATHSFFQEHSFLYIHTPIITTSDCEGAGEMFQVTTLINHTERVEQDLIDNPPPTEADVEAA 237
224122518 157 RPRTNTISAVARIRNALAFATHSFFQEHGFLYIHTPIVTTSDCEGAGEMFQVTTLINEAEKLDKELIENPPPTEADIEAA 236
297793179 161 RSRTNSISAVARIRNALAFATHSFFQEHSFLYIHTPIITTSDCEGAGEMFQATTLINYTERLEQDLIDNPPPTEADVEAA 240
15241897  241 RLIVIERGNVVAELKAAKASKEAITAAVAELKIAKETFAHIDERSRLRPGLPKKDGNIDYSKDFFGRQAFLTVSGQLQVE 320
15223302  238 RLIVKERGEAVAQLKVAKASKEEITASVAQLSVAKASLAHVEERLRLKPGLPKNDGKIDYSNDFFGRQAFLTVSGQLQVE 317
224122518 237 RLTVMQKGEIVAQLKAAKATRDDISAAVAGLKIAKENLSRLEERAKLKPGIPKKDGKIDYAQDFFARQAFLTVSGQLQVE 316
297793179 241 RLIVKERGDVVAKLKAAKASKEEITAAVAELKIAKESFAHIEERSKLKPGLPKKDGNVDYSKDFFGRQAFLTVSGQLQVE 320
15241897  321 TYACALSNVYTFGPTFRAENSHTSRHLAEFWMVEPEIAFADLEDDMNCAEAYVKYMCNWLLEKCYADMELMAKNFDSGCI 400
15223302  318 TYACALSSVYTFGPTFRAENSHTSRHLAEFWMVEPEIAFADIHDDMNCAEAYVKYMCKWLMDKCGDDMELMDKNVDEGCT 397
224122518 317 TYACAVTSVYTFGPTFRAEHSHTSRHLAEFWMVEPEIAFADLQDDMNCAEAYVKYMCQWLLDKCFDDMELMAKLYDKGCI 396
297793179 321 TYACALSSVYTFGPTFRAENSHTSRHLAEFWMVEPEIAFADLEDDMNCAEAYVKYMCKWLLDKCRDDMELMAKNFDSGCI 400
15241897  401 DRLKLVASTPFGRITYTKAIELLEEAVAKGK-EFDNNVEWGIDLASEHERYLTEVLF-QKPLIVYNYPKGIKAFYMRLND 478
15223302  398 KRLNMVAKASFKRVTYTEAIERLEKAVAQGKvVFDNKVEWGIDLASEHERYLTEVEFdQKPIIVYNYPKGIKAFYMRLND 477
224122518 397 DRLRMVSSTPFERISYTEAVRLLEEAVRGGK-EFEKNVEWGIDLASEHERYLTEEIF-KKPVIVYNYPKGIKAFYMRLND 474
297793179 401 DRLELVESTPFGRITYTEAIELLEEAVAKGK-EFDNKVEWGIDLASEHERYLTEVLF-QKPLIVYNYPKGIKAFYMRLND 478
15241897  479 DEKTVAAMDVLVPKVGELIGGSQREERYDVIKKRIEEMGLPIEPYEWYLDLRRYGTVKHCGFGLGFERMILFATGLDNIR 558
15223302  478 DEKTVAAMDVLVPKVGELIGGSQREERYDVIKQRIEEMGLPMEPYEWYLDLRRYGTVKHCGFGLGFERMIQFATGIDNIR 557
224122518 475 DSKTVAAMDILVPKVGELIGGSQREERYEVIQQRIAEMGLPLEPYDWYLDLRRYGTVKHCGFGLGFERMILFATGIDNIR 554
297793179 479 DEKTVAAMDVLVPKVGELIGGSQREERYDVIKKRIEEMGLPIEPYEWYLDLRRYGTVKHCGFGLGFERMILFATGIDNIR 558
15241897  559 DVIPFPRYPGKADL 572
15223302  558 DVIPFPRYPGKADL 571
224122518 555 DVIPFPRYPGRADL 568
297793179 559 DVIPFPRYPGKADL 572
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap