Conserved Protein Domain Family
PLN02220

?
PLN02220: PLN02220 
delta-9 acyl-lipid desaturase
Statistics
?
PSSM-Id: 177866
View PSSM: PLN02220
Aligned: 13 rows
Threshold Bit Score: 525.522
Threshold Setting Gi: 18402641
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
18402641    1 MSVTSTVEENHQKNPSTpaaveekkKRRWVFWDRRWRRLDYVKFSASFTVHSLALLAPFYFTWSALWVTFLFYTIGGLGI 80 
15221454    1 MCDPIREDGSNKRGAVS--------KEKRPYIHREWSWADIIRALTVINVHFLCLLAPFNYKWEALRFGFVLYALTSLSI 72 
15221393    1 MSLSASEKEENNKKMAAdka--emgRKKRAMWERKWKRLDIVKAFASLFVHFLCLLAPFNFTWPALRVALIVYTVGGLGI 78 
15221394    1 MGDTTKDDGSSQSKAVR--------GEKRAFFFRKWTRIDIARASAVGAVHLLCLLAPFNYKWEALRFGVILAIVTSLSI 72 
15221395    1 MSETTKDDGSSQKKSVR--------KEKRAYVLRKWTQFDVGRASTVGTVHLLCLLAPFNYKWEAFRFGIILAILTNLCI 72 
15221398    1 MGDKNKDDSSSQSKAVR--------KEKRAFLFRKWTRVDVMRVSAVGAVHLLCLLAPFNYTWEAFRFAAMVGISTNLSI 72 
30679651    1 MCDPTRDDGSSRSRVVSt-------MQKRAYFQRQWPLVDVVRASVVVIVHFLCLLAPFNFKWEALRFGLVLFALTTLSI 73 
297826577   1 MSVTSTVEENHQKNPSTppe--ekkKRRWVFWDRRWRRLDYVKFSASFTVHSLALLAPFYFTWSALWVTFLFYTIGGLGI 78 
297843406   1 MSLSASEKEENHRKMAAdka--emgRKKRALWERKWKRLDIVKAFASLFVHFLCLLAPFNFTWPALRVALIVYTVGGLGI 78 
297843408   1 MGDTTKDDGSSQSKAVR--------RGKRAFFFRKWTRIDVMRASAVGSVHLLCLLAPFNFKWEAFRFGVILAIVTSLSI 72 
297843410   1 MSDTTKDDGSSQNKSVR--------KEKRAPFLRKWTQFDVGRASTVGIVHLLCLLAPFNYKWEALRFGTIITIVTNLSI 72 
297848910   1 MCDPTRDDVSSQSRAVS--------IEKRAYFQRKWPLVDVIRALTVVIVHFLCLLAPFNYEWEAFRFGLVLFVITTLSI 72 
297848912   1 MCDPIREDGSSQRGALS--------KEKRPYIHREWSWADIIRALTVMVVHFLCLLAPFNYKWEALRFGLVLYALTSLSI 72 
18402641   81 TVSYHRNLAHRSFKVPKWLEYLLAYCALLAIQGDPIDWVSTHRYHHQFTDSERDPHSPKEGFWFSHLLWIYDSAYLVSKC 160
15221454   73 TFSYHRNLAHRSFKLPKWLEYPLAYFAVFALQGDPLDWVSIHRFHHQFTDSDRDPHSPIEGFWFSHVWWICDTRYIKYKC 152
15221393   79 TVSYHRNLAHRSFKVPKWLEYFFAYCGLLAIQGDPIDWVSTHRYHHQFTDSDRDPHSPNEGFWFSHLLWLFDTGYLVEKC 158
15221394   73 TFSYHRNLTHKSFKLPKWLEYPFAYSALFALQGHPIDWVSTHRFHHQFTDSDRDPHSPIEGFWFSHVFWIFDTSYIREKC 152
15221395   73 TFSYHRNLTHRSFKLPKWLEYPFAYSALLALQGDPLDWVSIHRFHHQFTDSDRDPHSPIEGFWFSHVLWIFDTDYIREKC 152
15221398   73 TFSYHRNLTHRSFKLPKWLEYPFAYSALFALQGHPIDWVSTHRFHHQFTDSDRDPHSPIEGFWFSHVFWIFDTSYIREKC 152
30679651   74 TFSFHRNLSHRSFKIPKWLEYPWAYSAVFALQGDPMDWVSIHRFHHQFTDSDRDPHSPKEGLLFSHILWIFDTQYIKYKC 153
297826577  79 TVSYHRNLAHRSFKVPKWLEYLLAYCALLAIQGDPIDWVSTHRYHHQFTDSERDPHSPKEGFWFSHLLWIYDSAYLVQKC 158
297843406  79 TVSYHRNLAHRSFKVPKWLEYFFAYCGLLAIQGDPIDWVSTHRYHHQFTDSDRDPHSPNEGFWFSHLLWLFDTGYLVEKC 158
297843408  73 TFSYHRNLTHRSFKLPKWLEYLFAYTALFALQGHPIDWVSTHRFHHQFTDSDRDPHSPIEGFWFSHVLWIFDTSYIREKC 152
297843410  73 TFSYHRNLTHRSFTLPKWLEYPFAYSALFALQGDPLDWVSIHRFHHQFTDSDRDPHSPIEGFWFSHVLWIFDSEYIREKC 152
297848910  73 TFSYHRNLSHRSFKIPKWIEYPFAYSAVFALQGDPMDWVSIHRFHHQFTDSDRDPHSPKEGLWFSHILWIFDTQYIKYKC 152
297848912  73 TFSYHRNLAHRSFKLPKWLEYPLAYFAVFALQGDPLDWVSIHRFHHKFTDSDRDPHSPIEGFWFSHVWWICDTRYIKYKC 152
18402641  161 GRRANVEDLKRQWFYRFLQKTVLFHILGLGFFLFYLGGMSFVTWGMGVGAALEVHVTCLINSLCHIWGTRTWKTNDTSRN 240
15221454  153 GGRNNVMDLKQQWFYWFLRMTIGFHVLMFWTVLYLYGGLPYLTCGGGVGGVIGYHVTWLVNSACHIWGSRSWKTKDTSRN 232
15221393  159 GRRTNVEDLKRQWYYKFLQRTVLYHILTFGFLLYYFGGLSFLTWGMGIGVAMEHHVTCLINSLCHVWGSRTWKTNDTSRN 238
15221394  153 GGRDNVMDLKQQWFYRFLRNTIGLHILTFWTLVYLWGGLPYLTCGVGVGGTIGYNGTWLINSACHIWGSRAWNTKDTSRN 232
15221395  153 GRRNNVMDLKQQWFYRFLKKTLVLHILAFWTLIYLWGGLPYLTWTVGFGGVIGYHGTWLVNSACHICGSQAWQTNDTSRN 232
15221398  153 GGRDNVMDLKQQWFYRFLQNTIGLHILTFWILVYLWGGLPYLTWSVGVGGAIGYHATWLINSACHIWGSRAWNTKDTSRN 232
30679651  154 GGRDNVLDLKKQWFYKFLRRTIAVHILMFWTILYLYGGLPYLTCGGGVGIFIGYHVTWLVNSACHIWGSRSWNTKDTSRN 233
297826577 159 GRRANVEDLKRQWFYRFLQKTVLFHILGLGFILFYLGGMSFVTWGMGVGAALEVHVTCLINSLCHIWGTRTWKTNDTSRN 238
297843406 159 GRRTNVEDLKRQWYYKFLQRTVLYHILAFGFLLYYFGGLSFLTWGMGIGVAMEHHVTCLINSLCHVWGSRTWKTNDTSRN 238
297843408 153 GGRDNVMDLKKQWFYRFLRNTIGLHILSFWTLVYLWGGLPYLTCGVGVGGAIGYNGTWLINSACHIWGTQAWNTKDTSRN 232
297843410 153 GRRNNVMDLKQQWFYRFLKKTLVLHIFVFWTLIYLWGGLPYLTWTVGSGGAFAYHGTWLVNSACHICGSQVWHTNDTSRN 232
297848910 153 GGRDNVMDLKKQWFYKFLRRTIALHIAMFWTVLYLYGGLPYLTCGGGVGGVIGYHVTWLVNSACHIWGSRSWKTKDTSRN 232
297848912 153 GGRNNVMDLKQQWFYRFLRMTIGFHVLMFWTVLYLYGGLPYLTCGGGVGGVIGYHVTWLVNSACHIWGSRSWKTKDTSRN 232
18402641  241 VWWLSVFSFGESWHNNHHAFESSARQGLEWWQIDISWYIVRFFEIIGLATDVKVPTEAQRRRMAIVR 307
15221454  233 VWWLSLFTMGESWHNNHHAFESSARQGLEWWQIDITWYLIRLFEVLGLATDVKLPSEIQKQKLALTR 299
15221393  239 VWWLSVFSFGESWHNNHHAFESSARQGLEWWQIDISWYIVRFLEIIGLATDVKLPSESQRRRMAMVR 305
15221394  233 IWWLGPFTMGESWHNNHHAFEASARHGLEWYQVDLTWYLICFFQALGLATDVKLPTDAQKRKLAFAR 299
15221395  233 VWWLALLTMGESWHNNHHAFETSARHGLEWYQLDITWYLIWFFQALGLATNVKLPTDAQKRKMAIRR 299
15221398  233 IWWLGPFTMGESWHNNHHAFEASARHGLEWYQVDLTWYLIWFFQVLGLATDVKLPTDAQKRKMSLAR 299
30679651  234 VWWLSLFTMGESWHNNHHAFESSARQGLEWWQIDITWYLIRLFEVLGIATDVKLPSELQKQKMALVR 300
297826577 239 VWWLSVFSFGESWHNNHHAFESSARQGLEWWQIDISWYIVRFFEIIGLATDVKVPTEAQRRRMAIVR 305
297843406 239 VWWLSVFSFGESWHNNHHAFESSARQGLEWWQIDISWYIVRFLEIIGLATDVKLPSESQRRRMAMVR 305
297843408 233 VWWLGPFTMGESWHNNHHAFEASARHGLEWYQVDLTWYLIWFFQALGLATDVKLPTDAQKRKMAFAR 299
297843410 233 VWWLALLTMGESWHNNHHAFEASARHGLEWYQLDITWYLIRFFQALGLATNVKLPTDDQKRKMAIPR 299
297848910 233 VWWLSLFTMGESWHNNHHAFESSARQGLEWWQIDITWYLIRLFEVLGLATDVKLPSDFQKQKMAIVR 299
297848912 233 VWWLSLFTMGESWHNNHHAFESSARQGLEWWQIDITWYLIRLFEVLGLATDVKLPSEFQKRKLALIR 299
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap