Conserved Protein Domain Family
PLN02219

?
PLN02219: PLN02219 
probable galactinol--sucrose galactosyltransferase 2
Statistics
?
PSSM-Id: 165863
View PSSM: PLN02219
Aligned: 4 rows
Threshold Bit Score: 1670.54
Threshold Setting Gi: 297820552
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
224138022   1 MTVTPKISINDGNLLVHGKTILTGVPDNIVLTPGSGVGPVAGAFIGATASHSQSLHVFPVGVLEDLRFMCCFRFKLWWMT 80 
15230330    1 MTITSNISVQNDNLVVQGKTILTKIPDNIILTPVTGNGFVSGSFIGATFEQSKSLHVFPIGVLEGLRFMCCFRFKLWWMT 80 
225441787   1 MTVTPKISINEGNLVVQGKTILTGVPDNIVLTPGSGGGLVAGTFIGATASHSKSLHVFPMGTLDGLRFMCCFRFKLWWMT 80 
297820552   1 MTITSNISVQNDNLVVQGKTILTKIPDNIILTPVTGNGFVSGAFIGATFEQSKSLHVFPVGVLEGLRFMCCFRFKLWWMT 80 
224138022  81 QRMGKCGKDIPLETQFMLVESRNGGEGvDQDDAQTIYTVFLPLLEGQFRAVLQGSDRNEMEICLDSGDSAVETNQGLNLV 160
15230330   81 QRMGSCGKDIPLETQFMLLESKDEVEG-NGDDAPTVYTVFLPLLEGQFRAVLQGNEKNEIEICFESGDKAVETSQGTHLV 159
225441787  81 QRMGTCGKDVPFETQFMLIESKETTEGgEHDDAPTIYTVFLPLLEGQFRAVLQGNDKNEIEICLESGDTAVETNQGLHLV 160
297820552  81 QRMGSCGKDIPLETQFMLLESKDEVEG-NGDDAPTIYTVFLPLLEGQFRAVLQGNEKNEIEICLESGDKAVETSQGTHLV 159
224138022 161 YMHAGTNPFEVINQAVMAVEKYMQTFLHREKKKLPSFLDWFGWCTWDAFYTDVTAEGVREGLESLSEGGTPPRFLIIDDG 240
15230330  160 YVHAGTNPFEVIRQSVKAVERHMQTFHHREKKKLPSFLDWFGWCTWDAFYTDVTAEGVDEGLKSLSEGGTPPKFLIIDDG 239
225441787 161 YMHSGTNPFEVIDQAVKAVEKHMQTFLHREKKKLPSFLDWFGWCTWDAFYTDVTAEGIEEGLQSLSKGGAPPKFLIIDDG 240
297820552 160 YVHAGTNPFEVIRQSVKAVERHMQTFHHREKKKLPSFLDWFGWCTWDAFYTDVTAEGVDEGLKSLSGGGTPPKFLIIDDG 239
224138022 241 WQQIENKAKEDaNVVVQEGAQFASRLTGIKENSKFQKNCEKNEQVIGLKHVVDDAKQCHNVKCVYVWHALAGYWGGVKPA 320
15230330  240 WQQIENKEKDE-NCVVQEGAQFATRLVGIKENAKFQKSDQKDTQVSGLKSVVDNAKQRHNVKQVYAWHALAGYWGGVKPA 318
225441787 241 WQQIGNENKDN-NCVVQEGAQFANRLTGIKENEKFQKNGRNNEQVPGLKHVVEDAKQRHNVKFVYVWHALAGYWGGVKPA 319
297820552 240 WQQIENKEKDE-NCVVQEGAQFATRLVGIKENAKFQKSDQKDTQVSGLKSVVDNAKQRHNVKQVYAWHALAGYWGGVKPA 318
224138022 321 AAGMEHYDTALAYPVQSPGVIGNQPDVVMDSLSVHGLGLVHPKKVFNFYNELHAYLASCGVDGVKVDAQNIIETLGAGHG 400
15230330  319 ASGMEHYDSALAYPVQSPGVLGNQPDIVMDSLAVHGLGLVNPKKVFNFYNELHSYLASCGIDGVKVDVQNIIETLGAGLG 398
225441787 320 AAGMEHYECALAYPVQSPGVMGNQPDIVMDSLSVHGLGLVPPRTVFNFYNELHAYLASCGVDGVKVDVQNIIETLGAGHG 399
297820552 319 ASGMEHYDSALAYPVQSPGVLGNQPDIVMDSLAVHGLGLVNPKKVFNFYNELHSYLASCGVDGVKVDVQNIIETLGAGLG 398
224138022 401 GRVSLTRSYHQALEASIARNFPDNGCIACMCHNTDGIYSAKQTAVVRASDDFYPRDPASHTIHISSVAYNTLFLGEFMQP 480
15230330  399 GRVSLTRSYQQALEASIARNFTDNGCISCMCHNTDGLYSAKQTAIVRASDDFYPRDPASHTIHIASVAYNSLFLGEFMQP 478
225441787 400 GRVALTRSYQQALEASIARNFTDNGCISCMCHNTDGLYSTKQTAVVRASDDFYPRDPASHTIHISSVAYNTLFLGEFMQP 479
297820552 399 GRVSLTRSYHQALEASIARNFTDNGCISCMCHNTDGLYSAKQTAIVRASDDFYPRDPASHTIHIASVAYNSLFLGEFMQP 478
224138022 481 DWDMFHSLHPAAEYHGAARAIGGCAIYVSDKPGNHNFDLLKKLVLPDGSVLRAQLPGRPTLDSLFADPARDGTSLLKIWN 560
15230330  479 DWDMFHSLHPTAEYHAAARAVGGCAIYVSDKPGNHNFDLLRKLVLPDGSVLRAKLPGRPTRDCLFADPARDGISLLKIWN 558
225441787 480 DWDMFHSLHPAAEYHGAARAVGGCAIYVSDKPGHHNFELLRKLVLPDGSVLRAQLPGRPTRDCLFADPARDGTSLLKIWN 559
297820552 479 DWDMFHSLHPTAEYHAAARAVGGCAIYVSDKPGNHNFDLLRKLVLPDGSVLRAKLPGRPTRDCLFADPARDGISLLKIWN 558
224138022 561 VNKCTGVVGVFNCQGAGWCKIEKKTRIHDETPGTLTGSVCASDVDCIAQVTGAKWNGETVVYAYKSGELVRLPKGASVPV 640
15230330  559 MNKFTGIVGVFNCQGAGWCKETKKNQIHDTSPGTLTGSIRADDADLISQVAGEDWSGDSIVYAYRSGEVVRLPKGASIPL 638
225441787 560 VNKCSGVVGVFNCQGAGWCKIEKKTRVHDTSPDTLTGSVCAADVDQIAHVAGTNWKGDVVVYAYKSGEVVRLPEGASLPV 639
297820552 559 MNKFTGIVGVFNCQGAGWCKETKKNQIHDTSPGTLTGSVCADDADQISQVAGEDWSGDSIVYAYRSGEVVRLPKGASIPL 638
224138022 641 TLKVLEYELFHFCPIDDIASNISFAPIGLLDMFNSGGAVEQVEIHMTSDKAPEHFDGEVSSElTTSLSENRFPTATIALR 720
15230330  639 TLKVLEYELFHISPLKEITENISFAPIGLVDMFNSSGAIESIDINHVTDKNPEFFDGEISSA-SPALSDNRSPTALVSVS 717
225441787 640 TLKVLEFEVFHFCPLKEIATNISFAPIGLLDMLNSGGAVEQFEVHMASEK-PELFDGEIPFElSTSLSENRSPTATIALT 718
297820552 639 TLKVLEYELFHISPLKEITANISFAPIGLLDMFNSSGAIESMDINPVTDKKHELFDGEVSSA-SPALSDNRSPTALISLS 717
224138022 721 VRGCGRFGAYSSQRPLKCTVGNVDTDFNHDSATGLLTLTLPVAEEEMYRWPVEIQV 776
15230330  718 VRGCGRFGAYSSQRPLKCAVESTETDFTYDAEVGLVTLNLPVTREEMFRWHVEILV 773
225441787 719 ARGCGRFGAYSSQRPLKCQVGDAEVEFSYDPNNGLLTFTIPIPEEEMYRWSIAIQV 774
297820552 718 VRGCGRFGAYSSQRPLKCAVGSTETDFTYDAEVGLVTLNLPVTSEEMFRWHVEILI 773
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap