Conserved Protein Domain Family
PLN02218

?
PLN02218: PLN02218 
polygalacturonase ADPG
Statistics
?
PSSM-Id: 177865
View PSSM: PLN02218
Aligned: 4 rows
Threshold Bit Score: 765.34
Threshold Setting Gi: 297820550
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15230328    1 MARCCRHLAVFLC-VLLMLSLCKAlSSNVDDGYGHEDGSFESDSLLKlNNDDVLSLISSDETTLEA-STVSVSNFGAKGD 78 
30688821    1 MARCTNLVTVFLLwALLMFSWCKA-SRISPNVYDHSYKRFKSDSLIK-RREDITGLRSFVRASLRTpTTVSVSDFGAKGD 78 
297820550   1 MARCCRLLAVFLC-VLLMLSLCEAlSSNVDDGYGHEDGSFESDSLIKlNNDDVLSLKSSDETTLES-STVSVSNFGAKGD 78 
297827843   1 MARCSKLVTVFLLwALLMFSWCKG-SRISPNGYDHSYKRFKSDSLIN-RKQDITGLRSFVRASLRTpTTVSVSDYGAKGD 78 
15230328   79 GKTDDTQAFKKAWKKACSTNGVTTFLVPKGKTYLLKSTRFRGPCKSLRNFQILGTLSASTKRSDYKDKNHWLILEDVNNL 158
30688821   79 GKTDDTQAFVNAWKKACSSNGAVNLLVPKGNTYLLKSIQLTGPCNSILTVQIFGTLSASQKRSDYKDISKWIMFDGVNNL 158
297820550  79 GKTDDTQAFKKAWKKACSTNGVTTFLIPKGKTYLLKSTRFRGPCKSLRNFQILGTLSASTKRSDYKDKNHWLILEDVNNL 158
297827843  79 GKTDDTQAFVNAWKKACSSNGAVNLLVPKGNTYFLKSIQLTGPCSSIITVQMFGTLSASQKRTDYKDISKWIMFDGVNSL 158
15230328  159 SIDGGSTGIINGNGKTWWQNSCKIDKSKPCTKAPTALTLYNLKNLNVKNLRVKNAQQIQISIEKCNKVEVSNVEITAPGD 238
30688821  159 SVDGGDTGVVDGNGETWWQNSCKRNKAKPCTKAPTALTFYNSKSLIVKNLKVRNAQQIQISIEKCSNVQVSNVVVTAPAD 238
297820550 159 SIDGGSTGIINGNGKIWWQNSCKIDKSKPCTKAPTALTLYNLKNLNVKNLRVRNAQQIQISIEKCNKVEVSNVVITAPGD 238
297827843 159 SVDGGGTGVVDGNGETWWQNSCKRNKAKPCTKAPTALTFYNSKSLIVENLRVRNAQQIQISIEKSSNVQVSNVVVTAPAD 238
15230328  239 SPNTDGIHITNTQNIRVSNSDIGTGDDCISIEDGTQNLQIFDLTCGPGHGISIGSLGDDNSKAYVSGINVDGAKFSESDN 318
30688821  239 SPNTDGIHITNTQNIRVSESIIGTGDDCISIESGSQNVQINDITCGPGHGISIGSLGDDNSKAFVSGVTVDGAKLSGTDN 318
297820550 239 SPNTDGIHITNTQNIRVSNSDIGTGDDCISIEDGTQNLQIFDLTCGPGHGISIGSLGDDNSKAYVSGINVDGAKFSESDN 318
297827843 239 SPNTDGIHITNTQNIRVSDSIIGTGDDCISIESGSQNVQINDITCGPGHGISIGSLGDDNSKAFVSGVTVDGAKLSGTDN 318
15230328  319 GVRIKTYQGGSGTAKNIKFQNIRMENVKNPIIIDQDYCDKDKCEDQESAVQVKNVVYKNISGTSATDVAITLNCSEKYPC 398
30688821  319 GVRIKTYQGGSGTASNIIFQNIQMDNVKNPIIIDQDYCDKSKCTTEKSAVQVKNVVYRDISGTSASENAITFNCSKNYPC 398
297820550 319 GVRIKTYQGGSGTAKNIKFQNIRMENVKNPIIIDQNYCDKDKCEEQGSAVQVKNVVYKNISGTSATDVAITLNCSEKYPC 398
297827843 319 GVRIKTYQGGSGTASNIIFQNIQMENVKNPIIIDQDYCDKSKCTSQQSAVQVKNVVYRNISGTSASDKAITFNCSKNYPC 398
15230328  399 QGIVLENVKIKGGTASCKNANVKNQGTVSPKCS 431
30688821  399 QGIVLDRVNIKGGKATCTNANVVDKGAVLPQCN 431
297820550 399 QGIVLENVNIKGGTASCKNANVKNQGTVSPKCS 431
297827843 399 LGIVLDKVNIKGGKATCTNANVVDKGAVFPQCN 431
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap