Conserved Protein Domain Family
PLN02214

?
PLN02214: PLN02214 
cinnamoyl-CoA reductase
Statistics
?
PSSM-Id: 177862
View PSSM: PLN02214
Aligned: 3 rows
Threshold Bit Score: 645.273
Threshold Setting Gi: 145323910
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15218377    1 MPVDVASPAGKTVCVTGAGGYIASWIVKILLERGYTVKGTVRNPDDPKNTHLRELEGGKERLILCKADLQDYEALKAAID 80 
145323910   1 MPVDVASPAGKTVCVTGAGGYIASWIVKILLERGYTVKGTVRNPDDPKNTHLRELEGGKERLILCKADLQDYEALKAAID 80 
297844516   1 MPVDEASPAGKTVCVTGAGGYIASWIVKILLERGYTVKGTVRNPDDPKNTHLRELEGAKERLILCKADLQDYEALKAAVD 80 
15218377   81 GCDGVFHTASPVTDDPEQMVEPAVNGAKFVINAAAEAKVKRVVITSSIGAVYMDPNRDPEAVVDESCWSDLDFCKNTKNW 160
145323910  81 GCDGVFHTASPVTDDPEQMVEPAVNGAKFVINAAAEAKVKRVVITSSIGAVYMDPNRDPEAVVDESCWSDLDFCKNTKNW 160
297844516  81 GCDGVFHTASPVTDDPEQMVEPAVNGAKFVINAAAEAKVKRVVITSSIGAVYMDPNRDPEAVVDESCWSDLDFCKNTKNW 160
15218377  161 YCYGKMVAEQAAWETAKEKGVDLVVLNPVLVLGPPLQPTINASLYHVLKYLTGSAKTYANLTQAYVDVRDVALAHVLVYE 240
145323910 161 YCYGKMVAEQAAWETAKEKGVDLVVLNPVLVLGPPLQPTINASLYHVLKYLTGSAKTYANLTQAYVDVRDVALAHVLVYE 240
297844516 161 YCYGKMVAEQAAWETAKEKGVDLVVLNPVLVLGPPLQPTINASLYHVLKYLTGSAKTYANLTQAYVDVRDVALAHVLVYE 240
15218377  241 APSASGRYLLAESARHRGEVVEILAKLFPEYPLPTKCKDEKNPRAKPYKFTNQKIKDLGLEFTSTKQSLYDTVKSLQEKG 320
145323910 241 APSASGRYLLAESARHRGEVVEILAKLFPEYPLPTKCKDEKNPRAKPYKFTNQKIKDLGLEFTSTKQSLYDTHRKNPWKM 320
297844516 241 APSASGRYLLAESALHRGEVVEILAKLFPEYPLPTKCKDENNPRAKPYKFTNQKIKDLGLEFTSTKQSLYDTVKSLQEKG 320
15218377  321 HLAppppppsASQESVENGIKIGS 344
145323910 321 ALR-------SGLEKLINSLKYPP 337
297844516 321 HLAppp--psTSQGSIENGIKIGS 342
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap