Conserved Protein Domain Family
PLN02213

?
PLN02213: PLN02213 
sinapoylglucose-malate O-sinapoyltransferase/ carboxypeptidase
Statistics
?
PSSM-Id: 165857
View PSSM: PLN02213
Aligned: 2 rows
Threshold Bit Score: 669.891
Threshold Setting Gi: 238479332
Created: 9-Dec-2010
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
145360230   1 MANIIFLDQPVGSGFSYSKTPIDKTGDISEVKRTHEFLQKWLSRHPQYFSNPLYVVGDSYSGMIVPALVQEISQGNYICC 80 
238479332   1 MANIIFLDQPVGSGFSYSKTPIDKTGDISEVKRTHEFLQKWLSRHPQYFSNPLYVVGDSYSGMIVPALVQEISQGNYICC 80 
145360230  81 EPPINLQGYMLGNPVTYMDFEQNFRIPYAYGMGLISDEIYEPMKRICNGNYYNVDPSNTQCLKLTEEYHKCTAKINIHHI 160
238479332  81 EPPINLQGYMLGNPVTYMDFEQNFRIPYAYGMGLISDEIYEPMKRICNGNYYNVDPSNTQCLKLTEEYHKCTAKINIHHI 160
145360230 161 LTPDCDVTNVTSPDCYYYPYHLIECWANDESVREALHIEKGSKGKWARCNRTIPYNHDIVSSIPYHMNNSISGYRSLIYS 240
238479332 161 LTPDCDVTNVTSPDCYYYPYHLIECWANDESVREALHIEKGSKGKWARCNRTIPYNHDIVSSIPYHMNNSISGYRSLIYS 240
145360230 241 GDHDIAVPFLATQAWIRSLNYSPIHNWRPWMINNQIAGYTRAYSNKMTFATIKASGHTAEYRPNETFIMFQRWISGQPL 319
238479332 241 GDHDIAVPFLATQAWIRSLNYSPIHNWRPWMINNQIAGYTRAYSNKMTFATIKGGGHTAEYRPNETFIMFQRWISGQPL 319
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap