Conserved Protein Domain Family
PLN02209

?
PLN02209: PLN02209 
serine carboxypeptidase
Statistics
?
PSSM-Id: 177859
View PSSM: PLN02209
Aligned: 3 rows
Threshold Bit Score: 876.273
Threshold Setting Gi: 297821539
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
42570887    1 MSLILKFMLLILLVSSH-HVRSGSIVKFLPGFKGPLPFELETGYIGIGEEENVQFFYYFIKSDKNPQEDPLIIWLNGGPG 79 
15227773    1 MSLILKFMLLILLVSSH-HVRSGSIVKFLPGFKGPLPFELETGYIGIGEEENVQFFYYFIKSDKNPQEDPLIIWLNGGPG 79 
297821539   1 ----LQFLLLLLLVLSHvDSGSTSIVKFLPGFEGPLPFELETGYIGIGEDENVQFFYYFIKSEKNLEEDPLLIWLNGGPG 76 
42570887   80 CSCLSGLFFENGPLALKNKVYNGSVPSLVSTTYSWTKTANIIFLDQPVGSGFSYSKTPIERTSDTSEVKKIHEFLQKWLI 159
15227773   80 CSCLSGLFFENGPLALKNKVYNGSVPSLVSTTYSWTKTANIIFLDQPVGSGFSYSKTPIERTSDTSEVKKIHEFLQKWLI 159
297821539  77 CSCLSGLFFENGPLALKNEVYNGTVPSLVSTTYSWTKTANIIYLDQPVGSGFSYSRIPIEKTSDTSEVKRIHEFLQKWLS 156
42570887  160 KHPQFLSNPFYVVGDSYSGMIVPALVHEISKGNYICCNPPINLQGYVLGNPITHIEFEQNFRIPYAHGMSLISDELYESL 239
15227773  160 KHPQFLSNPFYVVGDSYSGMIVPALVHEISKGNYICCNPPINLQGYVLGNPITHIEFEQNFRIPYAHGMSLISDELYESL 239
297821539 157 KHPQFFSNPFYVVGDSYSGMIVPALVQEISNGNYICCNPPINLQGYVLGNPITHIEFEQNFRIPYAHGMSLISDELYKSM 236
42570887  240 KRICKGNYFSVDPSNKKCLKLVEEYHKCTDNINSHHTLIANCDDSNTQHISPDCYYYPYHLVECWANNESVREALHVDKG 319
15227773  240 KRICKGNYFSVDPSNKKCLKLVEEYHKCTDNINSHHTLIANCDDSNTQHISPDCYYYPYHLVECWANNESVREALHVDKG 319
297821539 237 KRICKGNYFNVDPRNTECLKLVEEYHMCTDKINSHHTLIADCDDSNTIHISPDCYYYPYHLVECWANTDSVRKALHVINA 316
42570887  320 SIGEWIRDHRGIPYKSDIRSSIPYHMNNSINGYRSLIFSGDHDITMPFQATQAWIKSLNYSIIDDWRPWMIKGQIAGYTR 399
15227773  320 SIGEWIRDHRGIPYKSDIRSSIPYHMNNSINGYRSLIFSGDHDITMPFQATQAWIKSLNYSIIDDWRPWMIKGQIAGYTR 399
297821539 317 SIGEWIRDNRGIPYNRDIMSSVPYHMNNSINGYRSLIFSGDHDITMPFQATQAWIKSLNYSITDDWRPWMIKDQIAGYTR 396
42570887  400 TYSNKMTFATVKASGHTAEYLPEESSIMFQRWISGQPL 437
15227773  400 TYSNKMTFATVKGGGHTAEYLPEESSIMFQRWISGQPL 437
297821539 397 TFSNKMTFAT--GGGHTAEYLPNESSIMFQRWLSGQPL 432
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap