Conserved Protein Domain Family
PLN02208

?
PLN02208: PLN02208 
glycosyltransferase family protein
Statistics
?
PSSM-Id: 177858
View PSSM: PLN02208
Aligned: 3 rows
Threshold Bit Score: 950.227
Threshold Setting Gi: 15227766
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15227766    1 MEPTFHAFMFPWFAFGHMIPFLHLANKLAEKGHQITFLLPKKAQKQLEHHNLFPDSIVFHPLTIPHVNGLPAGAETTSDI 80 
42572855    1 MEPKFHAFMFPWFAFGHMIPFLHLANKLAEKGHRVTFLLPKKAQKQLEHHNLFPDSIVFHPLTVPPVNGLPAGAETTSDI 80 
297809125   1 MKRKFHAFMFPWFAFGHMIPFLHLANKLAEKGHRVTFLLPKKAQKQLEHHNLFPDSIVFHPLTIPPVNGLPAGAETTSDI 80 
15227766   81 SISMDNLLSEALDLTRDQVEAAVRALRPDLIFFDFAHWIPEIAKEHMIKSVSYMIVSATTIAYTFAPGGVLGVPPPGYPS 160
42572855   81 PISLDNLLSKALDLTRDQVEAAVRALRPDLIFFDFAQWIPDMAKEHMIKSVSYIIVSATTIAHTHVPGGKLGVRPPGYPS 160
297809125  81 PISMDNFLSEALDLTRDQVEAAVRALRPDMIFFDFAQWVPEMAKEHMIKSVSYIIVCATTIAHTHVPGGKLGVPPSSYPS 160
15227766  161 SKVLYRENDAHALATLSIFYKRLYHQITTGFKSCDIIALRTCNEIEGKFCDYISSQYHKKVLLTGPMLPEQDTSKPLEEQ 240
42572855  161 SKVMFRENDVHALATLSIFYKRLYHQITTGLKSCDVIALRTCKEVEGMFCDFISRQYHKKVLLTGPMFPEPDTSKPLEER 240
297809125 161 SKVFFRENDAHALATLSIFYKRLYHQITTGLKNCDVIAMRTCKEIEGKFCDYISRQYHKKVLLTGPMFPEPDTTKPLEEH 240
15227766  241 LSHFLSRFPPRSVVFCALGSQIVLEKDQFQELCLGMELTGLPFLIAVKPPRGSSTVEEGLPEGFQERVKGRGVVWGGWVQ 320
42572855  241 WNHFLSGFAPKSVVFCSPGSQVILEKDQFQELCLGMELTGLPFLLAVKPPRGSSTVQEGLPEGFEERVKDRGVVWGGWVQ 320
297809125 241 WSHFLSGFTPKSVVFCSFGSQIILEKDQFQELCLGMELTGLPFLVAVKPPRGSSTVQEGLPQGFEERVKGRGVVWGGWVQ 320
15227766  321 QPLILDHPSIGCFVNHCGPGTIWECLMTDCQMVLLPFLGDQVLFTRLMTEEFKVSVEVSREKTGWFSKESLSDAIKSVMD 400
42572855  321 QPLILAHPSIGCFVNHCGPGTIWESLVSDCQMVLIPFLSDQVLFTRLMTEEFEVSVEVPREKTGWFSKESLSNAIKSVMD 400
297809125 321 QPLILSHPSIGCFVNHCGPGTIWESLVSDCQMVLIPFLSDQVLFTRLMTEEFEVSVEVYREKTGWFSKESLSNAIKSVMD 400
15227766  401 KDSDLGKLVRSNHAKLKETLGSHGLLTGYVDKFVEELQEYLI 442
42572855  401 KDSDIGKLVRSNHTKLKEILVSPGLLTGYVDHFVEGLQENLI 442
297809125 401 KDSDLGKLVRSNHTKLKEILVSPGLLTGYVDNFVEALQEDLI 442
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap