Conserved Protein Domain Family
PLN02207

?
PLN02207: PLN02207 
UDP-glycosyltransferase
Statistics
?
PSSM-Id: 177857
View PSSM: PLN02207
Aligned: 5 rows
Threshold Bit Score: 994.16
Threshold Setting Gi: 297789302
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
297822697   1 MRNTELIFIPTPTVGHLVPFLEFARRLIEQDDRIRITILLMKLQGQSHLDTYVKSIASSQPFVRFIDVPELEEKPTLGgT 80 
15227606    1 MRNAELIFIPTPTVGHLVPFLEFARRLIEQDDRIRITFLLMKQQGQSHLDSYVKTISSSLPFVRFIDVPELEEKPTLG-T 79 
15227610    1 MRNVELIFIPTPTVGHLVPFLEFARRLIEQDDRIRITILLMKLQGQSHLDTYVKSIASSQPFVRFIDVPELEEKPTLGsT 80 
297822695   1 MRNAELIFIPTPTVGHLVPFLEFARRLIDQDDRIRITILLMKQQGQSHLDSYVKSIASSQPFVRFIDVPELEEKPTLG-T 79 
297789302   1 --------------------MEILWRLIEQDDRIRITILLMKLQGQSHLDTYVKSMASSQPFVRFIDVPELEEKPTLGgT 60 
297822697  81 QSVEAYVYDVIEKNIPLVRNIVMDILSSLALDGVKVKGFVADFFCLPMIDVAKEViSLPFYVFLTTNSGFLAMMKYLADR 160
15227606   80 QSVEAYVYDFIETNVPLVQNIIMGILSSPAFDGVTVKGFVADFFCLPMIDVAKDA-SLPFYVFLTSNSGFLAMMQYLAYG 158
15227610   81 QSVEAYVYDVIERNIPLVRNIVMDILTSLALDGVKVKGLVVDFFCLPMIDVAKDI-SLPFYVFLTTNSGFLAMMQYLADR 159
297822695  80 QSVEAYVYDFIEKNIPLVRNIIIGILSSPAFDGVTVKGFVADFFCLPMIDVAKDV-SLPFYVFLTTNSGFLAMMQYLAVR 158
297789302  61 QSVEAYVYDVIEKNIPLVRNIVMDILSSLALDGVKVKGFVADFFCLPMIDVAKEViSLPFYVFLTTNSGFLAMMKYLADR 140
297822697 161 HSKDTSVFVRNSEEMLSIPGFVNPVPANVLPSALFVEDGYDAYIKLAILFTKANGILVNSSFDIEPYSVNHFLDERSYPS 240
15227606  159 HKKDTSVFARNSEEMLSIPGFVNPVPAKVLPSALFIEDGYDADVKLAILFTKANGILVNTSFDIEPTSLNHFLGEENYPS 238
15227610  160 HSRDTSVFVRNSEEMLSIPGFVNPVPANVLPSALFVEDGYDAYVKLAILFTKANGILVNSSFDIEPYSVNHFLQEQNYPS 239
297822695 159 HKKDTSVFARNSEEMLSIPGFENPVPAKVLPSALFVEDGYDADVKLATLFTKANGILVNTSFDIEPTSLNHFLEEQNYPS 238
297789302 141 HSKDTSVFVRNSEEMLSIPGFVNPVPANVLPSALFVEDGYDAYIKLAILFTKANGILVNSSFDIEPYSVNHFLDERSYPS 220
297822697 241 VYAVGPVFDLKAQPHPEQDLARRDELMKWLDDQPDASVVFLCFGSMGRLRGPLVKEIAHALELCQYRFLWSLRTEEMTND 320
15227606  239 VYAVGPIFNPKAHPHPDQDLACCDESMKWLDAQPEASVVFLCFGSMGSLRGPLVKEIAHGLELCQYRFLWSLRTEEVTND 318
15227610  240 VYAVGPIFDLKAQPHPEQDLTRRDELMKWLDDQPEASVVFLCFGSMARLRGSLVKEIAHGLELCQYRFLWSLRKEEVTKD 319
297822695 239 IYAVGPIFNPKAHPHPDQDLARCDESMKWLDAQPEASVVFLCFGSMGSLRGPLVKEIAHGLELCQYRFLWSLRTEEVTND 318
297789302 221 VYAVGPVFDLKAQPHPEQDLARRDELMKWLDDQPDASVVFLCFGSMGRFRRPLVKEIAHALELCQYRFLWSLRTEEMTND 300
297822697 321 DLFPEGFLDRVSGRGMICGWSPQVEILAHKAVGGFVSHCGWNSIVESLWFGVPIVTWPMYAEQQLNAFLMVKELELAVEL 400
15227606  319 DLLPEGFMDRVSGRGMICGWSPQVEILAHKAVGGFVSHCGWNSIVESLWFGVPIVTWPMYAEQQLNAFLMVKELKLAVEL 398
15227610  320 DL-PEGFLDRVDGRGMICGWSPQVEILAHKAVGGFVSHCGWNSIVESLWFGVPIVTWPMYAEQQLNAFLMVKELKLAVEL 398
297822695 319 DLLPEGFIDRVGGRGMICGWSPQVEILAHKAVGGFVSHCGWNSIVESLWFGVPIVTWPMYAEQQLNAFLMVKELKLAVEM 398
297789302 301 DLFPEGFLDRVSGRGMICGWSPQVEILAHKAVGGFVSHCGWNSIVESLWFGVPIVTWPMYAEQQLNAFLMVKELELAVEL 380
297822697 401 KLDYRVYSDEIVNANEIETAIRCVMSKDNNVVRKRVMDISKMARKATCNGGSSYSAIEKFIHDVIGIKP 469
15227606  399 KLDYSVHSGEIVSANEIETAISCVMNKDNNVVRKRVMDISQMIQRATKNGGSSFAAIEKFIHDVIGTRT 467
15227610  399 KLDYRVHSDEIVNANEIETAIRYVMDTDNNVVRKRVMDISQMIQRATKNGGSSFAAIEKFIYDVIGIKP 467
297822695 399 KLDYSVHSGELVSANEIETAIRCVMNKDNNVVRKRVMGISQMVQRATKNGGSSFAAIEKFIHYVIGART 467
297789302 381 KLDYRVYSDEIVNANEIETAIRCVMSKDNNVVRKRVMDISKMARKATYNGGSSYSAIEKFIHDVIGIKL 449
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap