Conserved Protein Domain Family
PLN02206

?
PLN02206: PLN02206 
UDP-glucuronate decarboxylase
Statistics
?
PSSM-Id: 177856
View PSSM: PLN02206
Aligned: 8 rows
Threshold Bit Score: 896.648
Threshold Setting Gi: 297828485
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15227109    1 MASELTNRRHEIEQPEAESYYPKPIKPWFVAIRPIRYMLREQRLVFVLVGIAIATLGFTIFSKSSnhQPIPYDvDPLSGY 80 
15229334    1 MASELINRRHETDQPTADAYYPKPIKPWFTVTRPMRYMLREQRLIFVLVGIAIATLVFTIFPRST--QSTPYS-DPFSGY 77 
186511349   1 MASELINRRHETDQPTADAYYPKPIKPWFTVTRPMRYMLREQRLIFVLVGIAIATLVFTIFPRST--QSTPYS-DPFSGY 77 
225437374   1 MGSELIFRGHE-TQPMADGYSPKPPKPWLSVVRPIRYMLREQRLLFTLVGIAIATVVFLLLPSSP--APYTHRfDPISDS 77 
224131118   2 GSSELIFRGHDETQPTPDAYSPKPAKPWLFVIRPVRYLLREKRLVFFLVGMAIATVFFTILPSS---SPHAHKyDPLPDS 78 
224064446   2 GSSELIFRGHDETQPASDAYSPKPPKPWLAVTRPIRYLLLEQRLVFILVGIAIATLFFTLLPSSS--SSSPYEhDPIPNT 79 
297828485   1 MASELTYRRHEMEQAEAESYYPKPIKPWFVAIRPIRYMLREQRLVFVLVGIAMATLGFTIFSKPSn-QPIPYDvDPLPGY 79 
297817618   1 MANELINRRHEADQPIADAYYPKPIKPWFMVTRPMRYMLREQRLIFVLVGIAIATLVFTIFPRST--QSSAYS-DPFSGY 77 
15227109   81 GMRSESSYLPA-TIHKKPSIEYMSRIGSAGGKIPLGLKRKVLRVVVTGGAGFVGSHLVDRLMARGDNVIVVDNFFTGRKE 159
15229334   78 GIRPDESYVPAiQAQRKPSLEYLNRIGATGGKIPLGLKRKGLRVVVTGGAGFVGSHLVDRLMARGDTVIVVDNFFTGRKE 157
186511349  78 GIRPDESYVPAiQAQRKPSLEYLNRIGATGGKIPLGLKRKGLRVVVTGGAGFVGSHLVDRLMARGDTVIVVDNFFTGRKE 157
225437374  78 YFPSETTTQLAhRVAYAGHGGGGFGFVNSGGKVPLGLKRKGLRIVVTGGAGFVGSHLVDRLIRRGDSVIVVDNFFTGRKE 157
224131118  79 FSHISHELTTPvRYKYYEPLQVGFQSANSGGKIPLGLKRKGLRIVVTGGAGFVGSHLVDRLIARGDSVIVVDNFFTGRKE 158
224064446  80 FSHFSHELTTP--------------MPNSGGKIPLGLKSKSLRIVVTGGAGFVGSHLVDRLIARGDSVIVVDNFFTGRKE 145
297828485  80 GMR---------SYEKKASIEYMSRIGSAGGKIPLGLKRKVLRVVVTGGAGFVGSHLVDRLMARGDNVIVVDNFFTGRKE 150
297817618  78 GIRPDESYVPAiQAQRKPSLEYLNRIGATGGKIPLGLKRKGLRVVVTGGAGFVGSHLVDRLMARGDTVIVVDNFFTGRKE 157
15227109  160 NVMHHFNNPNFEMIRHDVVEPILLEVDQIYHLACPASPVHYKFNPVKTIK--TNVVGTLNMLGLAKRVGARFLLTSTSEV 237
15229334  158 NVMHHFSNPNFEMIRHDVVEPILLEVDQIYHLACPASPVHYKFNPVKTIK--TNVVGTLNMLGLAKRVGARFLLTSTSEV 235
186511349 158 NVMHHFSNPNFEMIRHDVVEPILLEVDQIYHLACPASPVHYKFNPVKTIK--TNVVGTLNMLGLAKRVGARFLLTSTSEV 235
225437374 158 NVMHHFGNPRFELIRHDVVEPLLLEVDQIYHLACPASPVHYKFNPVKTIK--TNVVGTLNMLGLAKRVGARFLLTSTSEV 235
224131118 159 NVMHHFKNPRFELIRHDVVEPLLLEVDQIYHLACPASPVHYKHNPVKTIK--TNVVGTLNMLGLAKRVGARFLLTSTSEV 236
224064446 146 NVMHHFKNPRFELIRHDVVEPLLLEVDQIYHLACPASPVHYKHNPVKTIK--TNVVGTLNMLGLAKRVGARFLLTSTSEV 223
297828485 151 NVMHHFSNPNFEMIRHDVVEPILLEVDQIYHLACPASPVHYKFNPVKTIIsfTNVVGTLNMLGLAKRVGARFLLTSTSEV 230
297817618 158 NVMHHFSNPNFELIRHDVVEPILLEVDQIYHLACPASPVHYKFNPVKTIK--TNVVGTLNMLGLAKRVGARFLLTSTSEV 235
15227109  238 YGDPLQHPQVETYWGNVNPIGVRSCYDEGKRTAETLTMDYHRGANVEVRIARIFNTYGPRMCIDDGRVVSNFVAQALRKE 317
15229334  236 YGDPLQHPQVETYWGNVNPIGVRSCYDEGKRTAETLTMDYHRGANVEVRIARIFNTYGPRMCIDDGRVVSNFVAQALRKE 315
186511349 236 YGDPLQHPQVETYWGNVNPIGVRSCYDEGKRTAETLTMDYHRGANVEVRIARIFNTYGPRMCIDDGRVVSNFVAQALRKE 315
225437374 236 YGDPLQHPQVETYWGNVNPIGVRSCYDEGKRTAETLTMDYHRGAEVEVRIARIFNTYGPRMCIDDGRVVSNFVAQALRKE 315
224131118 237 YGDPLQHPQVETYWGNVNPIGVRSCYDEGKRTAETLAMDYHRGAGVEVRIARIFNTYGPRMCIDDGRVVSNFVAQALRKE 316
224064446 224 YGDPLQHPQVETYWGNVNPIGVRSCYDEGKRTAETLTMDYHRGAGVEVRIARIFNTYGPRMCIDDGRVVSNFVAQALRKE 303
297828485 231 YGDPLQHPQVETYWGNVNPIGVRSCYDEGKRTAETLAMDYHRGANVEVRIARIFNTYGPRMCIDDGRVVSNFVAQALRKE 310
297817618 236 YGDPLQHPQVETYWGNVNPIGVRSCYDEGKRTAETLTMDYHRGANVEVRIARIFNTYGPRMCIDDGRVVSNFVAQALRKE 315
15227109  318 PLTVYGDGKQTRSFQFVSDLVEGLMRLMEGEHVGPFNLGNPGEFTMLELAKVVQETIDPNAKIEFRPNTEDDPHKRKPDI 397
15229334  316 PLTVYGDGKQTRSFQFVSDLVEGLMRLMEGEHVGPFNLGNPGEFTMLELAKVVQETIDPNANIEFRPNTEDDPHKRKPDI 395
186511349 316 PLTVYGDGKQTRSFQFVSDLVEGLMRLMEGEHVGPFNLGNPGEFTMLELAKVVQETIDPNANIEFRPNTEDDPHKRKPDI 395
225437374 316 PLTVYGDGKQTRSFQYVSDLVEGLIRLMEGEHVGPFNLGNPGEFTMLELAQVVQETIDPNAKIEFRPNTEDDPHKRKPDI 395
224131118 317 PMTVYGDGKQTRSFQFVSDLVEGLMRLMEGEHVGPFNLGNPGEFTMLELAQVVQETIDPNARIEFRPNTEDDPHKRKPDI 396
224064446 304 PMTVYGDGKQTRSFQFVSDLVEGLMRLMEGEHVGPFNLGNPGEFTMLELAQVVQETIDPNARIEFRPNTEDDPHKRKPDI 383
297828485 311 PLTVYGDGKQTRSFQFVSDLVEGLMRLMEGEHVGPFNLGNPGEFTMLELAKVVQETIDPNAKIEFRPNTEDDPHKRKPDI 390
297817618 316 PLTVYGDGKQTRSFQFVSDLVEGLMRLMEGEHVGPFNLGNPGEFTMLELAKVVQETIDHNANIEFRPNTEDDPHKRKPDI 395
15227109  398 TKAKELLGWEPKVALRQGLPLMVKDFRQRVFGDQKQDSSTTSSSTE 443
15229334  396 TKAKELLGWEPKVSLRQGLPLMVKDFRQRVFGDQKEGSSAAATTTK 441
186511349 396 TKAKELLGWEPKVSLRQGLPLMVKDFRQRVFGDQKEGSSAAATTTK 441
225437374 396 SKAKDLLGWEPKVALRKGLPLMVSDFRERIFGDHKEDGATTTTSSS 441
224131118 397 TKAKDLLGWEPKIPLRKGLPMMVSDFRQRIFGDHREEGTATNTSTS 442
224064446 384 TKAKDLLGWEPKISLRQGLPMMVSDFRQRVFGDHKEEGTTSTMSTS 429
297828485 391 TKAKELLGWEPKVALRQGLPLMVKDFRQRVFGDQKQASSTTSSSTE 436
297817618 396 TKAKELLGWEPKVSLRQGLPLMVKDFRQRVFGDQREGSSAAATTTK 441
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap