Conserved Protein Domain Family
PLN02205

?
PLN02205: PLN02205 
alpha,alpha-trehalose-phosphate synthase [UDP-forming]
Statistics
?
PSSM-Id: 177855
View PSSM: PLN02205
Aligned: 5 rows
Threshold Bit Score: 1858.53
Threshold Setting Gi: 297841523
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
42572029    1 MVSRSYSNLLELASGDSPTFGRMNRQIPRIMAVAGIMSNIDNDSKD-------TDLSPKDRIIIVANELPIRAQRRVDGN 73 
224101911   1 MVSRSYSNLLELASGESPSFERMNRRIPRIMTVAGIMSDIDDDPSEsvcsdpsSSSVQMCRIIIVANQLPIRAQRKSDGS 80 
224108257   1 MVSRSYSNLLELASGESPSFGRMSRRIPRIMTVAGIMSDIDDDPSEsvcsdpsSSSTPKDRIIIVANQLPIRAQRKSDGS 80 
225424409   1 MVSRSYSNLLELASGESPSFGRMSRRIPRIMTVAGIISDLDDDPSEsvcsdpsSSSVQRDRLIIVANQLPIRAQRKSENN 80 
297841523   1 MVSRSYSNLLELASGDSPTFGRMNRQIPRIMAVAGIMSNIDNDSKE-------TDLSPKDRIIIVANELPIRAQRRLEGS 73 
42572029   74 GsgssssstccskGWNFSWDENSLLLQLKDGLGDEAIEVIYVGCLKEEIPLNEQEEVYQILLESFKCVPTFLPLDLYTRY 153
224101911  81 K------------SWIFNWDENSLLLQLKDGLGDDEIEVIYVGCLKEEVHLSEQEEVSQTLLETFKCVPTFLPPDLFSRY 148
224108257  81 K------------SWIFSWDENSLLLQLKDGLGDDEIEVIYVGCLKEEVHPNEQDEVSQILLETFKCVPTFLPPDLFSRY 148
225424409  81 N------------GWIFSWDENSLLLQLKDGLGDDEIEVIYVGCLKEEIHPCEQDEVSQILLETFKCVPTFLPPDLFTRY 148
297841523  74 Gsstst---ccskGWNFSWDENSLLLQLKDGLGDEAIEVIYVGCLKEEIPLNEQEEVYQVLLESFKCVPTFLPLDLYTRY 150
42572029  154 YHGFCKQQLWPLFHYMLPLSPDLGGRFDRTLWQAYVSVNKIFADRIMEVINPEDDFVWIHDYHLMVLPTFLRKRFNRVKL 233
224101911 149 YHGFCKQQLWPLFHYMLPLSPDLGGRFNRSLWQAYVSVNKIFADRIMEVINPEDDFVWVHDYHLMVLPTFLRKRCNKVKL 228
224108257 149 YHGFCKQQLWPLFHYMLPLSPDLGGRFNRSLWQAYVSVNKIFADRIMEVINPEDDFVWVHDYHLMALPTFLRKRFNKVKL 228
225424409 149 YHGFCKQQLWPLFHYMLPLSPDLGGRFNRSLWQAYVSVNKIFADRIMEVINPEDDFVWIHDYHLMVLPTFLRKRFNRVKL 228
297841523 151 YHGFCKQQLWPLFHYMLPLSPDLGGRFDRALWQAYVSVNKIFADRIMEVINPEDDFVWIHDYHLMVLPTFLRKRFNRVKL 230
42572029  234 GFFLHSPFPSSEIYKTLPIREELLRALLNSDLIGFHTFDYARHFLSCCSRMLGLTYESKRGYIGLEYYGRTVSIKILPVG 313
224101911 229 GFFLHSPFPSSEIYKTLPIREELLRALLNSDLIGFHTFDYARHFLSCCSRMLGLSYESKRGYMGIEYCGRTVSIKILPVG 308
224108257 229 GFFLHSPFPSSEIYKTLPIREELLRALLNSDLIGFHTFDYARHFLSCCSRMLGLSYESKRGYIGIEYCGRT--------- 299
225424409 229 GFFLHSPFPSSEIYRTLPIREELLRALLNSDLIGFHTFDYARHFLSCCSRMLGLSYESKRGYIGLEYYGRTVSIKILPVG 308
297841523 231 GFFLHSPFPSSEIYKTLPIREELLRALLNSDLIGFHTFDYARHFLSCCSRMLGLTYESKRGYIGLEYYGRTVSIKILPVG 310
42572029  314 IHMGQLQSVLSLPETERKVGELIERYGRKGRTMLLGVDDMDIFKGITLKLLAMEQLLMQHPEWQGKVVLVQIANPARGKG 393
224101911 309 IHMGQLQSVLSLPETEAKVKELIKQFCDQDRIMLLGVDDMDIFKGISLKLLAMEQLLVQHPEWQGNIVLVQIANPARGKG 388
224108257 300 -----LQSVLSLPETEAKVKELIKQFSDQDRIMLLGVDDMDIFKGISLKLLAMEQLLMQHPEWQGKIVLVQIANPARGKG 374
225424409 309 IHMGQLQSVLSLPETEEKVAELIKQFCDQDRIMLLGVDDMDIFKGISLKLLAMEQLLVQHPEWQGKVVLVQIANPARGRG 388
297841523 311 IHMGQLQSVLSLPETERKVGELIERYGRKGRTMLLGVDDMDIFKGITLKLLAMEQLLMQHPEWQGKVVLVQIANPARGKG 390
42572029  394 KDVKEMQAETYSTVKRINETFGRPGYDPIVLIDAPLKFYERVAYYVVAECCLVTAVRDGMNLIPYEYIVSRQGNEKLDKI 473
224101911 389 KDVKEVQAETHAVVKRINETFGKPGYDPIVLIDAPLKFYEKVAYYVVAECCLVTAVRDGMNLIPYEYIISRQGNDRLNKL 468
224108257 375 KDVKEVQAETHAAVKRINETFGKPGYDPIVLIDAPLKFYEKVAYYVVAECCLVTAVRDGMNLIPYEYIISRQGNDRLNKL 454
225424409 389 KDVKEVQTETFSTVKRINETFGKPGYDPVVLIDEPLKFYERIAYYVVAECCLVTAVRDGMNLIPYEYIISRQGNEKLDKV 468
297841523 391 KDVKEMQAETYSTVKRINETFGRPGYDPIVLIDAPLKFYERVAYYVVAECCLVTAVRDGMNLIPYEYIVSRQGNEKLDKI 470
42572029  474 LKLEANNRnKKSMLVVSEFIGCSPSLSGAIRVNPWNVDAVADAMDSALEVAEPEKQLRHEKHYKYVSTHDVGYWARSFLQ 553
224101911 469 LGQEPSTP-KKSMLVISEFIGCSPSLSGAIRVNPWNIDAVADAMDCALEMADPEKQLRHEKHYRYVSTHDVGYWARSFFQ 547
224108257 455 LGQEPSTP-KKSMLVISEFIGCSPSLSGAIRVNPWNIDAVADAMDFALEMAEPEKQLRHEKHYRYVSTHDVGYWARSFLQ 533
225424409 469 LGLESSIP-KKSMLVVSEFIGCSPSLSGAIRVNPWNIDAVADAMDSALEMLEPEKQLRHEKHYRYVSTHDVGYWARSFLQ 547
297841523 471 LKLEPNNHnKKSMLVVSEFIGCSPSLSGAIRVNPWNVDAVADAMDSALEVAEPEKQLRHEKHYKYVSTHDVGYWARSFLQ 550
42572029  554 DLERSCGEHGRRRCWGIGFGLSFRVVALDQSFRKLSMEHIVSAYKRTKTRAILLDYDDTLMPQGSIDKRPSSKSIDILNT 633
224101911 548 DLERTCRNHSRRRCWGIGFGLSFRVVALDPNFKKLSMERIVSAYKRTTTRAILLDYDGTLMPQASIDKSPSSKSIGIINS 627
224108257 534 DLERTCRDHSRRRCWGIGFGLSFRVVALDPNFKKLSMERIVSAYKRTTTRAILLDYDGTLMPQASIDKSPSSKSIDIINN 613
225424409 548 DLERTCRDHVRRRCWGIGFGLSFRVVALDPNFRKLSMEHIVSAYKRTTTRAILLDYDGTLMPQASIDKGPTPKSIEMLKT 627
297841523 551 DLERSCGEHGRRRCWGIGFGLSFRVVALDQSFRKLSMEHIVSAYKRTKTRAILLDYDDTLMPQGSIDKRPSSKSIDILNT 630
42572029  634 LCRDKGNLVFIVSAKSRETLSDWFSPCEKLGIAAEHGYFLRLRKAVEWENCVAAVDCSWKQIAEPVMELYTETTDGSTIE 713
224101911 628 LCRDKNNMVFLVSARSRKKVAEWFSQCVRLGLAAEHGYFLRLMRDAEWETCVPVADTTWKQIAEPVMQLYTETTDGSTVE 707
224108257 614 LCRDKNNMVFLVSARSRNTVAEWFSECEKLGLAAEHGYFLRLKRDAEWETRVPVADTTWKQIAEPVMQLYTETTDGSTIE 693
225424409 628 LCRDENNMVLIVSARSRKKLEDWFSPCENLGIAAEHGYFLRPKGDVEWETCVPVADCSWKQIAEPVMKLYTETTDGSTIE 707
297841523 631 LCRDKGNLVFIVSAKSRETLSDWFSPCEKLGIAAEHGYFLRLRKAVEWENCVAAADCSWKQIAEPVMELYTETTDGSTIE 710
42572029  714 DKETALVWSYEDADPDFGSCQAKELLDHLESVLANEPVTVKRGQNYVEVKPQGVSKGLIARRMLSMMQERGTLPEFVLCI 793
224101911 708 DKETALVWCYEDADPDFGSCQAKELLDHLESVLANEPVTVKSGQNIVEVKPQGVSKGLVAKRLLSIMQENEISPDFVLCI 787
224108257 694 DKETSLVWCYEDADPDFGSCQAKELLDHLESVLANEPVTVKSGQNIVEVKPQGVSKGLVAKRLLSIMQENEMSPDFVLCI 773
225424409 708 DKETALAWCYEDADPDFGSCQAKELLDHLESVLANEPVTVKSGQSLVEVKPQGVSKGIVAKRLLSTMQERGMLPDFVLCI 787
297841523 711 DKETALVWSYEDADPDFGSCQAKELLDHLESVLANEPVTVKRGQNYVEVKPQGVSKGLIARRMLSMMQERGTLPEFVLCI 790
42572029  794 GDDRSDEDMFEVICSSTegpSIAPRAEIFACTVGQKPSKAKYYLDDTTEIVRLMHGLASVTDQITPV 860
224101911 788 GDDRSDDDMFEVITTSM---TATQNAEVFACTVGQKPSKAKYYLDDTAEIVRLMQGLASVSEQTLTE 851
224108257 774 GDDRSDEDMFEVITTSMagpSIAENAEVFACTVGRKPSKAKYYLDDTAEIVRLMQGLASVSEQVLSE 840
225424409 788 GDDRSDEDMFEAITSSMagsSIAPRAEVFACTVGRKPSKAKYYLDDTGEIVRLMQGLASVSEQPVPL 854
297841523 791 GDDRSDEDMFEVICSSTegpSIAPRAEIFACTVGQKPSKAKYYLDDTTEIVRLMHGLASVTDQITPV 857
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap