Conserved Protein Domain Family
PLN02203

?
PLN02203: PLN02203 
aldehyde dehydrogenase
Statistics
?
PSSM-Id: 165847
View PSSM: PLN02203
Aligned: 10 rows
Threshold Bit Score: 880.986
Threshold Setting Gi: 115459684
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
42567452    1 MEAMKETVEESLREMRETFASGRTRSLKWRKAQIGAIYEMVKDNEDKICNALFQDLGKHSTEAFRDELGVVLRTATVAIN 80 
115447597  12 KPKPAVVLGGMVSGLREVYESGRTKDLEWRQSQLKALIRLLTDKEEEIFAVLHDDLGKHRGESFRDELGILVKSIKYTLQ 91 
115447591   3 EKPQHGSLGGLVAGVREEYESGRTKELEWRKAQLGGLIRMITEEEDAIFDALHDDLGKHRVESFRDEVGVLAKSVRNTLQ 82 
115459684  19 ALGPGETVSGTVAELRAAYESGRTRSLEWRQSQLRGLLRLLAEEEAAAFRALREDLGKHQAEAYRDEIGVLVKSANAALR 98 
224055033   1 --------------MRQYFRSGKTKDVAWRQSQLKGLLSFIKETERDMCKALKEDLGKHHVEAYRDEVGILTKSINFALH 66 
224097106   1 ----MEGLEGTLAELRDTFKSGRTRSVAWRKSQLRAMIEFVQDNEEEMFKVLDQDLGKHPVEAYRDEVGVVAKSAKLSLS 76 
225431229   2 IGMEGGRVEESIGELRRTFRSGETRSAAWRKAQLKALLQLLRDNENKIFEALKQDLGKHPVESYRDELGVVEKSVKYSLS 81 
225435464   1 -MAEIENLEPDLEELRESYRSGKTKEASWRKSQLKGLLTLLKEQEKDIFKALEQDLGKHYAESYRDEVGTLTKSVNLALS 79 
242063104   7 ETAALDNIGDLVSDLREVYESGRTQDMEWRQSQLRGLVRLLEDEEEAIFDALHEDLGKHRVEAFRDEVGVLKKSVVDKLQ 86 
297802310   1 MEGMKETVEESLREMRETFASGRTRSLKWRKAQIGAIYEMVKDNEDKICSALFQDLGKHSTEAFRDELGVVLRSATVAIN 80 
42567452   81 CLDKWAVPKHSKLPLLFYPAKGKVISEPYGTVLVLSSWNFPISLSLDPLIGAIAAGNTVLLKSSELSPNASAFLAKTIPA 160
115447597  92 NLKKWAASERAESPLVAFPATAMVVPEPLGVVLVFSCWNLPLGLALEPLSGAIAAGNAVVLKPSELAPSTAAFLAANIPR 171
115447591  83 NLKKWASPEKVDVPLISFPCNARVVPEPIGVVLIFSCWNLPIGLALEPLSGAIAAGNAVVLKPSEFAPSTAAFLAANIPK 162
115459684  99 EVGKWMAPEKVWVPLIAFPARAQLEPQPLGVILVFSCWNVPLGLSLEPLVGALAAGNAVALKPSELAPATAKFLGDNVGK 178
224055033  67 GLKEWMSSKKAKLPRVALLSSAELVPEPLGFVLIISSWNFPFGLSLEPMIGAIAAGNTMVLKPSELAPASASLLANVLPT 146
224097106  77 CVEKWMAPKKGNLPLAFFPASAEVMPEPFGVVLIMGSWNFPISLTLDPLIGAISAGNVVVLKPSELSPACSSFLAEAIPK 156
225431229  82 HVDEWMAPKKSSLPLIFFPGKGQVLPEPLGLVLIFSSWNFPISLALDPVIGAISAGNSVVLKPSEQAPACSSFLANTIPL 161
225435464  80 SLKDWMSSRKAKLPIATFPSTAEVFPEPLGLVLIISSWNFPFGLSLEPVIGAIAAGNSVVLKPSELAPASSSLLAKTIPT 159
242063104  87 NLKKWAAPEKAHTPLVAFPATALVVPEPLGVVLIFSCWNLPIGLALEPLSGALAAGNAAVVKPSELAPSTSAFLAANIPK 166
297802310  81 SLDKWAVPKHSNLPLLFYPAKGKVISEPYGTVLVLSSWNFPISLSLDPLIGAIAAGNTVLLKSSELSPNASAFLAKTIPA 160
42567452  161 YLDTKAIKVIEGGPDVATILLQHQWDKIFFTGSPKIGRIIMAAAAQHLTPVTLELGGKCPTIVDHH-TISKNIKSVVKRI 239
115447597 172 YLDSRAVKVVLGGPNVGEELMEHRWDKVLFTGSARIGRIIMAKAVKHLTPVALELGSKCPCIVDWL-DSKRDRQIAVNRI 250
115447591 163 YLDANAVKVVQGGAEVGEELMEHRWDKVLFTGNARVGRIIMTKAAKHLTPVALELGSKCPCIVDCL-DSKRECQVAVNRI 241
115459684 179 YMDATAVKVIQGGPEVGEQLMEHRWDKVLFTGSPRIARVVMAAAAKHLTPVALELGGKCPCIFDTIgGSARDLQTAVNRV 258
224055033 147 YLDNSAVKVIQGGPAVGERLLQQKWDKIFFTGSARVGRIIMSAAVKHLTPVALELGGKCPAVVDSV-SSSWDTKVTVNRI 225
224097106 157 YLDPKSIKVIEGGIDVCEQLLQQNWDKIFFTGSQRVGRIVMTAAAQHLTPVTLELGGKSPAILDSS-SNPTNMKVIAKRI 235
225431229 162 YLDSKAIKVIEGGAAISQQLLQQKWDKIFFTGSPSVARIVMSAAVKHLTPVTIELGGKCPTIFDNL-SSPSDTEVAVKRV 240
225435464 160 YLDKKAVKVIEGGAAVGEHLLRCKWDKIFFTGNPRVGRVVMTAAANHLTPVTLELGGKCPAIFDSF-SSSWDKEMVIKRV 238
242063104 167 YLDSKAVKVVEGGPEVGDKLMDYPWDKVLFTGSSRVGRLIMTKAAKHLTPVALELGSKCPCIVDWL-DSNRDSQIAVNRI 245
297802310 161 YLDTKAIKVIEGGPDVATILLQHQWDKIFFTGSPKIGRIIMAAAAQHLTPVTLELGGKCPTIVDHH-TISKNIKSVVKRI 239
42567452  240 AGGKWGSCNGQACISVDYVLIEKSFAPTLIDMLKPTIKSFFGenpkESGCLSRIANKHHVQRLSRLLSDPRVQASIVYGG 319
115447597 251 IGAKWSTCAGQACIAIDHVIVEERFAPILIELLKSTLKRFMA----KPGGMARILNAKHFERLSGYLEDNRVAASVVHGG 326
115447591 242 IGAKWSTCAGQACVAIDYILVEEQFAPFLIELLKSTLKRFFT----EPEYMARILNEKHFHRLTNLLEDDQVKSSIVHGG 317
115459684 259 VGGKWSSCAGQACLAIDYVLVEERFVPVLIKALKSTLKKFFA----DSDHMARIVNARHFQRLSDLLKDKSVAASVLHGG 334
224055033 226 LVSKFGACAGQACIAIDYILVEKRFASILVELMKVMIKKMFGenprETNTVARIVNEQHFLRLKNLLSDSAVQNSIVYGG 305
224097106 236 VAAKWGSCSGQACIAIDYMLVEEKFASYLIDLLEKTIKQFFGenprESKSLCKILNKNNFMRLLDLLKDPLIRASVVYGG 315
225431229 241 VGGKWGPCNGQACIGVDYVLVEEKFASHLIEMLKKTIKKFYGenpkELKDISKIVNKHHFQRLHNLLKEPLVAASIVHGG 320
225435464 239 LGGKFGACAGQACIAIDYILVQEGFAPTLLELLRNMTKKMFGenprETKSMARIINKKHFLRLKNILDDPSVQSCIVHGG 318
242063104 246 IGAKWSTCSGQACIAIDYLLVEEEFAPILIEMLKSTLERFFT----RPEYMARILNEKHFQRLSGFLADRRVASSVVHGG 321
297802310 240 AGGKWGSCSGQACISVDYVLIEKSYASSLIDMLKPTIKSFFGenpkESGCLSRIATKQHVQRLSRLLNDPRVQASIVYGG 319
42567452  320 SIDEDKLYVEPTILLDPPLDSEIMNEEIFGPILPIITVRDIQESIGIINTKPKPLAIYAFTNDENLKTRILSETSSGSVT 399
115447597 327 YMDPKKLNIEPTLLLNPPADSDVMTEEVFGPILPIITVKKIEDCIAYLKSKPKPIAMYAFTNNERLKRRIVEETSSGSVT 406
115447591 318 NADPKTLWIEPTIVLNPPFDSDIMMEEIFGPLLPIITVKKTEDCIAFLKSKPKPLAIYAFTNNEKLKQRIVAETSSGSVL 397
115459684 335 TLDAKNLCIEPTILLNPPLDSAIMTEEIFGPLLPIITVKKIEDSIAFVRARPRPLAVYAFTKNAALRRRIVEETSSGSVT 414
224055033 306 SMDEKNLFVEPTILVDPPLDAAIMTEEIFGPLLPIITLDKVEDSIAFINSKPKPLAIYAFTNNEKFRRRMLSETSSGSLV 385
224097106 316 SVDEETMYIEPTILLNPPLDSQIMTEEIFGPLLPIITLNNIHDSIEFISSRPKPLAIYAFTRDETFKKQILSKTSSGSVT 395
225431229 321 LIDEEKLFIEPTILLDPPLDAEIMTEEIFGPLLPIITLKNIEESIEFINSRPKPLALYAFTNDEAFKRRILSETSSGSVT 400
225435464 319 GVDEDNLFIEPTILMNPPLKASIMTDEIFGPLLPIITLKKIEDSIEFINSRPKALAIYVFTKNETLKRRIISETSSGSVT 398
242063104 322 HFNPKTLSIEPTLLLNPPLDSDIMTEEIFGPLLPIITVKKIEDSIKFLKSKPKPLAIYAFTRNEKLKQRIIDETSSGSVT 401
297802310 320 SIDEEKLYVEPTILLDPPLDSEIMNEEIFGPILPIITVRDIQESIGIIKTKPKPLAIYAFTNDENLKTRILSETSSGSVT 399
42567452  400 FNDVMIQYMCDALPFGGVGESGIGRYHGKYSFDCFSHEKAIMEGSLGMDLEARYPPWNNFKLTFIRLAFREAYFKLILL- 478
115447597 407 FNDAVVQYALESVPFGGVGHSGFGQYHGKYSFELFSHKKAVFKRSFLIEFMFRYPPWDERKIGTLRHVFSYNYFLLFFN- 485
115447591 398 FNDAIVQYGLDSVPFGGIGESGFGQYHGKYTFELFSHRKAVVRRSLLVEFMFRYPPWDEYKMGMLRRVFRFDYVSLVLAl 477
115459684 415 FNDAVVQYGIDSLPFGGVGESGFGQYHGKYSFEMFSHKKAVLTRGYLIELTARYPPWDDSKISMMRQLYRYNYVGFVLT- 493
224055033 386 FNDAVIQYAADALPFGGIGESGIGKYHGKFSFDTFSHYKAVTRRSFLTDFWFRFPPWNDYKLLLLEATYNYDYLGMLLV- 464
224097106 396 FNDTLLQFVCDSLPFGGVGQSGFGRYHGKYSFDTFSHEKAILQRRFFPELEPRYPPWNNLKFQFIKLLYAFNYIGLLLL- 474
225431229 401 FNDIIIQFVCDTLPFGGVGQSGFGRYHGKYSFDTFSHEKAVLRRSFFLELEPRFPPWNDFKLKFIRLVYSFDYLGLILL- 479
225435464 399 FNDAIIQYAADTIPFGGVGESGFGRYHGKFSFDTFTHEKAILRRSLLTEFWFRFPPWNDFKLALTKSAYRFDYFEFLLV- 477
242063104 402 FNDAIVQYGLDSIPFGGVGHSGFGQYHGKYTFEMFSHKKAVLKRSLLVEFMFRYPPWDETKIGMLRRVYRFDYVSLFLA- 480
297802310 400 FNDVMIQYMCDALPFGGVGESGIGRYHGKYSFDCFSHEKAIMEGSLGMDLDARYPPWNNFKLTFIRLAFREAYFKLILL- 478
42567452  479 ----MLGLKR 484
115447597 486 ----LLGFRR 491
115447591 478 lafwLLGIRR 487
115459684 494 ----FLGLKK 499
224055033 465 ----ILGLKR 470
224097106 475 ----LLGLKK 480
225431229 480 ----LLGLKR 485
225435464 478 ----LLGLKK 483
242063104 481 ----IVGLRR 486
297802310 479 ----MLGLKR 484
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap