Conserved Protein Domain Family
PLN02202

?
PLN02202: PLN02202 
carbonate dehydratase
Statistics
?
PSSM-Id: 177853
View PSSM: PLN02202
Aligned: 2 rows
Threshold Bit Score: 558.519
Threshold Setting Gi: 30693687
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
30693687    1 MKIMMMIKLCFFSMSLICIAPADAQTEGVVFGYKGKNGPNQWGHLNPHFTTCAVGKLQSPIDIQRRQIFYNHKLNSIHRE 80 
297819992   1 MKMVMMIKLCFLAIALLCIAPANAQTQGVVFGYKGKNGPNQWGHLNPHFTKCAVGKLQSPIDIQRRQIFYNRRLESLHRD 80 
30693687   81 YYFTNATLVNHVCNVAMFFGEGAGDVIIENKNYTLLQMHWHTPSEHHLHGVQYAAELHMVHQAKDGSFAVVASLFKIGTE 160
297819992  81 YYFTNATLVNHVCNVAMFFGEGAGDVIIDNKNYTLLQMHWHTPSEHHLHGVQYAAELHMVHQAKDGSFAVVASLFKIGTE 160
30693687  161 EPFLSQMKEKLVKLKEERLKGNHTAQVEVGRIDTRHIERKTRKYYRYIGSLTTPPCSENVSWTILGKVRSMSKEQVELLR 240
297819992 161 EPFLSQMKDKLVKLKEERFKGSQTAQVEVGKIDTRHIERKTRKYFRYVGSLTTPPCSENVSWTILGKVRSMSKEQVELLR 240
30693687  241 SPLDTSFKNNSRPCQPLNGRRVEMFHDheRVDKKETGNKKKKPN 284
297819992 241 SPLDKSFKNNSRPCQPLNGRRVEMFHD--RVDKKDTGNKKKRPN 282
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap