Conserved Protein Domain Family
PLN02201

?
PLN02201: PLN02201 
probable pectinesterase/pectinesterase inhibitor
Statistics
?
PSSM-Id: 177852
View PSSM: PLN02201
Aligned: 6 rows
Threshold Bit Score: 954.714
Threshold Setting Gi: 225465284
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
240256136   1 MSCLKYFLILLMLGLCVSSEEN------FQYDYLKVPASEFVSSINTIVVVIRQVSSILSQFADFSGDRRLQNAVSDCLD 74 
30690925    7 MGSSIFFLFLIIISLCSAHKEAfsstdlVQMECLRVPPLEFAEAAKTVVDAITKAVAIVSKFDKKAGKSRVSNAIVDCVD 86 
225465284  15 FFTIFFFFISCSSSTFASSSDEeanlklLQSQCLAVPSSAFISSLKSTIDVLRGTMSVVSQFTKVFNDFRLSNAISDCLE 94 
224069288   4 ISTLSLFLLLLTFFPPVCTAHAssitddLQNNCLKVPVNQFVGSLTSTLDIIRDVISIISNFGNVFGDIRLTNAITDCLD 83 
297802670   1 MSCLKYFLIFLILGLCVSSEEN------LQYEYLKVPASEFVSSINTIVVVIRQVSSILSQFADFSGGRRLQNAVSDCLD 74 
297818778   7 MGSSIFFFFLITVSLCSAHKEAfsstglVQMECLKVPPLEFAQAAKTVVDAIQKAVAIVSKFDKKVGKSRVSNAILDCVD 86 
240256136  75 LLDFSSEELTWSASASENPKGKGNGTGDVGSDTRTWLSAALSNQATCMEGFDGTSGLVKSLVAGSLDQLYSMLRELLPLV 154
30690925   87 LLDSAAEELSWIISASQSPNGKDNSTGDVGSDLRTWISAALSNQDTCLDGFEGTNGIIKKIVAGGLSKVGTTVRNLLTMV 166
225465284  95 LLDFAADDLSWSLSAIQNPKGKDNGTGDLGSDLKTWLSSTFTNQDTCIEGFVGTNGIVKTVVAESLSQVASLVHSLLTMV 174
224069288  84 LLDFSADELSWSMSASQNPNGKHNSTGDLSSDLRTWLSAALVNQDTCIEGFDGTNNILKGLVSGSLNQITSSVQELLKNV 163
297802670  75 LLDFSSEELSWSASASENPKGKGNGTGDVGSDTRTWLSAALSNQDTCMEGFQGTSGLVKSLVAGSLDQLYSMLRELLPLV 154
297818778  87 LLDSAAEELSWIISASQNPNGKDNSTGDVGSDLRTWISAALSNQDTCLDGFEGTNGIIKKIVAGGLSRVGTTVRNLLTMV 166
240256136 155 QPeqkpkavskpgPIAKGPKAPPGRKLRDTDEDESLQFPDWVRPDDRKLLESNGRT-YDVSVALDGTGNFTKIMDAIKKA 233
30690925  167 HS-----------PPSKPKPKPIKAQTMTKAHSGFSKFPSWVKPGDRKLLQTDNITvADAVVAADGTGNFTTISDAVLAA 235
225465284 175 HD-----------PAPKGKSNGGGGGV---KHVGSGDFPSWVGKHSRKLLQASSVS-PDVTVAADGTGNYTTVMDAVQAA 239
224069288 164 DP--------------HTNSKSSGGGFSGSKSGNNDRFPSWVKHEDRKLLVLNGVT-PNVIVAADGTGNFTKIMDAVAAA 228
297802670 155 QPeqkpkpiskpgPIAKGPKAPPGRKLRDTDDDESLQFPDWVRSEDRKLLETNGRS-YDVCVALDGTCNFTKIMDAIKEA 233
297818778 167 HS-----------PPSKAKPKPIKAHTMTKAHSGFSKFPSWVKPGDRKLLQTDNITvADAVVATDGTGNFTTISDAVLAA 235
240256136 234 PDYSSTRFVIYIKKGLYLENVEIKKKKWNIVMLGDGIDVTVISGNRSFIDGWTTFRSATFAVSGRGFLARDITFQNTAGP 313
30690925  236 PDYSTKRYVIHVKRGVYVENVEIKKKKWNIMMVGDGIDATVITGNRSFIDGWTTFRSATFAVSGRGFIARDITFQNTAGP 315
225465284 240 PDYSQNHYVIYIKQGIYRENVEIKKKKWNLMMVGDGMGATVITGNRSYIDGWTTYASATFAVKGKGFIARDMTFENTAGP 319
224069288 229 PDYSMHRHIIYIKKGVYNEYVDIKKKKWNLMMVGEGMNATIITGNRNFIDGWTTFRSATFAVSGRGFIARDITFENTAGP 308
297802670 234 PDYSSTRFVIYIKKGLYLENVEIKKKKWNIVMIGDGIDVTVISGNRSFIDGWTTFRSATFAVSGRGFLARDITFQNTAGP 313
297818778 236 PDYSTKRYVIHVKRGVYEENVEIKKKKWNIMIVGDGIDATVITGNRSFIDGWTTFRSATFAVSGRGFIGRDITFQNTAGP 315
240256136 314 EKHQAVALRSDSDLSVFFRCAMRGYQDTLYTHTMRQFYRECTITGTVDFIFGDGTVVFQNCQILAKRGLPNQKNTITAQG 393
30690925  316 EKHQAVAIRSDTDLGVFYRCAMRGYQDTLYAHSMRQFFRECIITGTVDFIFGDATAVFQSCQIKAKQGLPNQKNSITAQG 395
225465284 320 EKHQAVALRSDSDLSVYYRCSMRGYQDTLYPHTNRQFYRECRISGTVDFIFGDATVVFQNCQILVKKGLPNQKNTITAQG 399
224069288 309 SKHQAVALRSDSDLSVFFRCEIKSYQDSLYTHTMRQFYRECRVSGTVDFIFGDATAVFQNCQILARKGLPDQKNTVTAHG 388
297802670 314 EKHQAVALRSDSDLSVFYRCAMRGYQDTLYTHTMRQFYRECTITGTVDFIFGDGTVVFQNCQILAKRGLPNQKNTITAQG 393
297818778 316 EKHQAVAIRSDTDLGVFYRCAMRGYQDTLYAHSMRQFFRECIITGTVDFIFGDATAVFQNCQIKAKQGLPNQKNSITAQG 395
240256136 394 RKDVNQPSGFSIQFSNISADADLVPYLNTTRTYLGRPWKLYSRTVFIRNNMSDVVRPEGWLEWNADFALDTLFYGEFMNY 473
30690925  396 RKDPNEPTGFTIQFSNIAADTDLLLNLNTTATYLGRPWKLYSRTVFMQNYMSDAINPVGWLEWNGNFALDTLYYGEYMNS 475
225465284 400 RKDPAQPTGFSIQFSNISADSDLLASVNSTLSYLGRPWKQYSRTIIMKSYISDAIRPEGWLEWNGDFALDTLYYGEYMNY 479
224069288 389 RKDPNQPTGYSFQFCNISADIDLLPYVNSSYTYLGRPWKNFSRTIIMQSYMSNAIRPEGWLEWNGNVYLDTLYYGEYINY 468
297802670 394 RKDVNQPSGFSIQFSNISADADLVPYLNTTRTYLGRPWKLYSRTVFIRNNMSDVVRPEGWLEWNADFALDTLFYGEFMNY 473
297818778 396 RKDPNEPTGFTIQFSNIAADTDLLPNSNTTATYLGRPWKLYSRTVFMQNYMSDAINPEGWLEWNGNFALDTLYYGEYMNS 475
240256136 474 GPGSGLSSRVKWPGYHVFNNSDQANNFTVSQFIKGNLWLPSTGVTFSDGLYI 525
30690925  476 GPGASLDRRVKWPGYHVLNTSAEANNFTVSQLIQGNLWLPSTGITFIAGLVS 527
225465284 480 GPSAGLGSRVQWPGFHLLNNSAQAANFTVTEFIAGNLWLPSTGVKYSAGLAV 531
224069288 469 GPGAGVGRRVRWPGFHMLNDSTQANNYTVAQFIQGNLWLPSTGVRYTAGLEV 520
297802670 474 GPGSGLSSRVKWPGYHVFNNSEQANNFTVSQFIKGNLWLPSTGVTFSDGLNI 525
297818778 476 GPGASLDRRVKWPGYHVLNTPAEANNFTVSQFIQGNLWLPSTGITFIAGLVS 527
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap