Conserved Protein Domain Family
PLN02199

?
PLN02199: PLN02199 
shikimate kinase
Statistics
?
PSSM-Id: 177850
View PSSM: PLN02199
Aligned: 9 rows
Threshold Bit Score: 557.003
Threshold Setting Gi: 145329214
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
145329216   1 MEAAITQRIQYPSWVDCRKVECKPqRGSLRY-SQQVKVDRRFRGLSLArlQPERRNDQRRAVspavscSDNNSSgALLET 79 
42573237    1 MEAATVQRFQYSSWNDLRNFEGKP-RGSLRYnTQRIKEDKRFRVVALT--LDKRRDHRLRSV------SDKNSS-ALLET 70 
30681570    1 MEAAITQRIQYPSWVDCRKVECKPqRGSLRY-SQQVKVDRRFRGLSLArlQPERRNDQRRAVspavscSDNNSS-ALLET 78 
30692396    1 MEAATVQRFQYSSWNDLRNFEGKP-RGSLRYnTQRIKEDKRFRVVALT--LDKRRDHRLRSV------SDKNSS-ALLET 70 
145362131   1 MEAAITQRIQYPSWVDCRKVECKPqRGSLRY-SQQVKVDRRFRGLSLArlQPERRNDQRRAVspavscSDNNSS-ALLET 78 
145329214   1 MEAAITQRIQYPSWVDCRKVECKPqRGSLRY-SQQVKVDRRFRGLSLArlQPERRNDQRRAVspavscSDNNSS-ALLET 78 
145329577   1 MEAAITQRIQYPSWVDCRKVECKPqRGSLRY-SQQVKVDRRFRGLSLArlQPERRNDQRRAVspavscSDNNSS-ALLET 78 
297797940   1 MEAATVQMFQYSSWTDLRNFEGKT-RGSLRY-TQRTKEDKRLRVVALA--LDKRRDHRQRSV------SDKNSS-ALLDT 69 
297821397   1 MEAAIAQRIQYPSWVDWREFEGKSlRGSLRY-SQRVKEEKRFRGLALAhlQPERR---KRSVssevlcSDNNSS-ALLEA 75 
145329216  80 GSVY--PFDEDI-----LKRKAEEVKPYLNGRSMYLVGMMGSGKTTVGKLMSKVLGYTFFDCDTLIEQAMNGTSVAEIFV 152
42573237   71 GSLLhsPFDEEQq---iLKKKAEEVKPYLNGRSMYLVGMMGSGKTTVGKIMARSLGYTFFDCDTLIEQAMKGTSVAEIFE 147
30681570   79 GSVY--PFDEDI-----LKRKAEEVKPYLNGRSMYLVGMMGSGKTTVGKLMSKVLGYTFFDCDTLIEQAMNGTSVAEIFV 151
30692396   71 GSLLhsPFDEEQq---iLKKKAEEVKPYLNGRSMYLVGMMGSGKTTVGKIMARSLGYTFFDCDTLIEQAMKGTSVAEIFE 147
145362131  79 GSVY--PFDEDI-----LKRKAEEVKPYLNGRSMYLVGMMGSGKTTVGKLMSKVLGYTFFDCDTLIEQAMNGTSVAEIFV 151
145329214  79 GSVY--PFDEDI-----LKRKAEEVKPYLNGRSMYLVGMMGSGKTTVGKLMSKVLGYTFFDCDTLIEQAMNGTSVAEIFV 151
145329577  79 GSVY--PFDEDI-----LKRKAEEVKPYLNGRSMYLVGMMGSGKTTVGKLMSKVLGYTFFDCDTLIEQAMNGTSVAEIFV 151
297797940  70 GSLLhsPFDEEQq---lLQKKAEEVKPYLNGRSMYLVGMMGSGKTTVGKIMARALGYTFFDCDTLIEQAMNGTSVAEIFE 146
297821397  76 GSVY--PFDEDLilkatLQRKAEEVKPFLNGRSMYLVGMMGSGKTTVGKLMSKVLGYSFFDCDSLIEQAMNGTSVAEIFV 153
145329216 153 HHGENFFRGKETDALKKLSSRY-QVVVSTGGGAVIRPINWKYMHKGISIWLDVPLEALAHRIAAVGTDSRPLLH-DESGD 230
42573237  148 HFGESVFREKETEALKKLSLMYhQVVVSTGGGAVIRPINWKYMHKGISIWLDVPLEALAHRIAAVGTGSRPLLHdDESGD 227
30681570  152 HHGENFFRGKETDALKKLSSRY-QVVVSTGGGAVIRPINWKYMHKGISIWLDVPLEALAHRIAAVGTDSRPLLH-DESGD 229
30692396  148 HFGESVFREKETEALKKLSLMYhQVVVSTGGGAVIRPINWKYMHKGISIWLDVPLEALAHRIAAVGTGSRPLLHdDESGD 227
145362131 152 HHGENFFRGKETDALKKLSSRY-QVVVSTGGGAVIRPINWKYMHKGISIWLDVPLEALAHRIAAVGTDSRPLLH-DESGD 229
145329214 152 HHGENFFRGKETDALKKLSSRY-QVVVSTGGGAVIRPINWKYMHKGISIWLDVPLEALAHRIAAVGTDSRPLLH-DESGD 229
145329577 152 HHGENFFRGKETDALKKLSSRY-QVVVSTGGGAVIRPINWKYMHKGISIWLDVPLEALAHRIAAVGTDSRPLLH-DESGD 229
297797940 147 HFGESVFREKETEALKKLSLMYnQVVVSTGGGAVIRPINWKYMHKGISIWLDVPLKALAHRIAAVGTGSRPLLHdDESGD 226
297821397 154 HHGENFFRGKETDALKKLSSMY-QVVVSTGGGAVIRPINWKYMHKGISIWLDVPLEALAHRIAAVGTGSRPLLH-DESGD 231
145329216 231 AYSVAFKRLSAIWDERGEAYTNANARVSLENIAAKRGYKNVSDLTPTEIAIEAFEQVLSFLEKEETMEIPDGdL 304
42573237  228 TYTAALNRLSTIWDARGEAYTKASARVSLENITLKLGYRSVSDLTPAEIAIEAFEQVQSYLEKEDGMARPDG-L 300
30681570  230 AYSVAFKRLSAIWDERGEAYTNANARVSLENIAAKRGYKNVSDLTPTEIAIEAFEQVLSFLEKEETMEIPDGdL 303
30692396  228 TYTAALNRLSTIWDARGEAYTKASARVSLENITLKLGYRSVSDLTPAEIAIEAFEQVQSYLEKEDGMARPDG-L 300
145362131 230 AYSVAFKRLSAIWDERGEAYTNANARVSLENIAAKRGYKNVSDLTPTEIAIEAFEQVLSFLEKEETMEIPDGdL 303
145329214 230 AYSVAFKRLSAIWDERGEAYTNANARVSLESMS-----------SSSILSAIAFVQSV---------------- 276
145329577 230 AYSVAFKRLSAIWDERGEAYTNANARVSLENIAAKRGYKNVSDLTPTEIAIEAFEQVLSFLEKEETMEIPDGdL 303
297797940 227 TYTAALNRLSTIWDARGEAYTNASARVSLESMTLKLGYRSVSDLTPTEIAMEAFEQVRSYLDKEDGMARPDG-F 299
297821397 232 AYSVAFKRLSTIWDERGEAYANANARVSLENIAAKRGYKDVSDLTPTEIAIEAFEQVLSFLEKEETMEIPDGdL 305
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap