Conserved Protein Domain Family
PLN02198

?
PLN02198: PLN02198 
glutathione gamma-glutamylcysteinyltransferase
Statistics
?
PSSM-Id: 177849
View PSSM: PLN02198
Aligned: 8 rows
Threshold Bit Score: 1014.23
Threshold Setting Gi: 224055697
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
79501722    5 MSLVRTATIALLLIAFL----------QNANAVKNLQSIVAYHGAVATDDGRCSAIGTNVLRQGGNAIDASVAAALCLGV 74 
22329258    1 MSLVRTVTIVLFIIAFL----------QNAAAQKRQQSIVKSRGAVATDDGRCSVIGMRVLREGGNAIDASVAAALCLGV 70 
42573241    1 MSLVRTVTIVLFIIAFL----------QNAAAQKRQQSIVKSRGAVATDDGRCSVIGMRVLREGGNAIDASVAAALCLGV 70 
224081230  28 SSLPSLWAILLFFLFLLcpatsslhgrQSGSTKFRHQEVVARHGAVATDDGRCSRIGIDVLREGGHAVDAAVAASLCLGV 107
224055697   1 ----------------------------------QRHDVVASHGVVATDDGRCSRIGMDALREGGHAVDAAVAASLCLGV 46 
297797976   1 MSLVRTVTIVLFIIAFL----------QNAAAQKRQQSIVKSRGAVATDDGRCSVIGMNVLREGGNAIDASVAAALCLGV 70 
297797978   5 MLLVRTATVALLLIAFL----------QNANAEKNQQSIVAYHGAVATDDGRCSEIGTNVLRQGGNAIDASVAAALCLGV 74 
297602847     --------------------------------------------------------------------------------    
79501722   75 VSPASSGIGGGAFTMIKLANGTEVAYDSRETAPLSATEDMYGDNPERKKKGSLSVGVPGEVAGLYTAWTQHGKLPWKQLV 154
22329258   71 VSPASSGIGGGAFTVVKIAGGKEIAYDSRETAPLRATENMYGGNVDLKKKGALSVGVPGEVAGLFTAWKQHGKLPWKRLV 150
42573241   71 VSPASSGIGGGAFTVVKIAGGKEIAYDSRETAPLRATENMYGGNVDLKKKGALSVGVPGEVAGLFTAWKQHGKLPWKRLV 150
224081230 108 VSPASSGIGGGAFMLIRLASGEVHAYDMRETAPMQASENMYDGNDTLKARGALSIAVPGELAGLYKAWKQHGRLPWERLV 187
224055697  47 VGLASSGMGGGSFMLILLASGEAQAFDMRETAPMKASEDMYAGNATKKARGALSIAVPGELAGLHRAWRKYGRLPWKRLV 126
297797976  71 VSPASSGIGGGAFTVVKIAGGKEIAYDSRETAPLSATENMYGGNVELKKKGALSVGVPGEVAGLFTAWKQHGKLPWKRLV 150
297797978  75 VSPASSGVGGGAFIVIKLANGEEIAYDSRETAPLSASENMYGGNPEQKKKGALSVAVPGEVAGLFTAWTKHGKLPWKQLV 154
297602847   1 ---------YYHFILIPLLNKQ---------------------------------------------------------- 13 
79501722  155 EPAEKLAaEGFKISKYLYMQMNATRSDILADKGLSELFVSNGELKKPGAICRNPKLADTLSQIAEYGPKAFYNGTVGFNL 234
22329258  151 TPAEKLA-EGFKISKYLYMQMNATRSDILADKGLSDLFVSNGELKKPGTICHNPKLALTLKLIGEYGPKAFYNGTVGVNL 229
42573241  151 TPAEKLA-EGFKISKYLYMQMNATRSDILADKGLSDLFVSNGELKKPGTICHNPKLALTLKLIGEYGPKAFYNGTVGVNL 229
224081230 188 RPAEKLArRGFKISRYLRMQMEKTQSGILADEGLRNVFTSNGDLLQQGDICYNKKLADTLRKISK-GVEAFYNGPIGFNL 266
224055697 127 RPAEQLAcKGFKISPYLHMQMVKTESGILADKGLRDLLTSNGKLLQPGNICHNKKLAHTLRKISKHGIEAFYNGSIGSKL 206
297797976 151 SPAEKLA-EGFKISKYLYMQMNATRSDILADKGLSDLFVSNGELKKPGTICHNPNLALTLRLIGEYGPKAFYNGTVGVNL 229
297797978 155 EPAEKLAaEGFEISKYLYMQMNATRSDILADKGLSELFVSNGELKKPGTIFQNPKLAFTLSQIAEYGPKAFYNGTVGANL 234
297602847     --------------------------------------------------------------------------------    
79501722  235 VSDIQKAGGIITLKDLQNYNVKVKEPLSTEILGYRLLGMPPPSSGGPAMMLILNILAQYGIPSGVSGPLGVHRLVEALKH 314
22329258  230 ARDIKKSGGIITLKDLQSYRVKIKEPLSADILGYRVLGMPPPSSGGAAMMLVLNILSQYGIPSGVSGPLGVHRLIEALKH 309
42573241  230 ARDIKKSGGIITLKDLQSYRVKIKEPLSADILGYRVLGMPPPSSGGAAMMLVLNILSQYGIPSGVSGPLGVHRLIEALKH 309
224081230 267 VRDIQKLGGILTIEDLQRYKVRVREPIITNILGYKIIGMPPPSSGGASMMLILNILAQYGVPEGISGPLGFHRLVESLKH 346
224055697 207 VKDIQKAGGILTREDLRRYQVKMRDPIVADILGFKILGMPPPSSGGASMMLILNILAQYGAPSGISGPLGIHREIEALKH 286
297797976 230 ARDILKSGGIITLKDLQSYRVKINEPLAADILGYRVLGMPPPSSGGAAMMLVLNILSQYGIPSGVSGPLGVHRLIEALKH 309
297797978 235 VSDIQKSGGIITLKDLQNYNVKVKEPLSADILGYRLLGMPPPSSGGPAMMLILNILAQYGIPYGVHGALGVHRLVEALKH 314
297602847  14 ---------------------------------------------------VLNILTQYGLPAGFSGSLGIHRLIESLKH 42 
79501722  315 AFAVRMNLGDPDFVpEVTNVVADMLSPKFAQDLKSKINDEKTFDPKYYGGKWGQIKDHGTSHLSIIDSERNAVSMTSTIN 394
22329258  310 AFAVRMNLGDPDFT-DVTKVVSDMLSPKFAKDLKSKINDQKTFDPKYYGGMWNQIDDHGTSHLSIIDRERNAVSMTSTIN 388
42573241  310 AFAVRMNLGDPDFT-DVTKVVSDMLSPKFAKDLKSKINDQKTFDPKYYGGMWNQIDDHGTSHLSIIDRERNAVSMTSTIN 388
224081230 347 AFAVRMKLGDPDFA-DVAQVVSDMISPKFAEELKKTIYDNMTFDPGHYGGRWNQINDHGTSHISIVDSERNAVSMTNTVN 425
224055697 287 AFAVRMNLGDPDFI-NVTEVVSDMLSPKFAEMLKKTIYDNMTFDPRHYGGRWNQIHDHGTSHISVVDIERNAVSMTNTVN 365
297797976 310 AFAVRMNLGDPDFT-DITKVVSDMLSPKFAQDLKRKINDEKTFDPKYYGGMWNQIDDHGTSHLSIIDRERNAVSMTSTIN 388
297797978 315 AFAVRMNLGDPDFVpDVTKVVSDMLSPKFAQDLKSKINDEKTFGPKFYGGKWNQIKDHGTSHLSIIDSERNAVSMTTTIN 394
297602847  43 YFAIRMNLGDPEFV-NVNEVVSDMMSPKFAADLKKTIYDNMTFDPKHYGGR----------------------------- 92 
79501722  395 GYFGAIMLSPSTGIVLNNEMDDFSIPTKSGGDPDVPPPAPANFIRPGKRPLSSMTPTIVLKDGKVKAALGASGGMYIIAG 474
22329258  389 GYFGALMLSPSTGIVLNNEMDDFSIPMKSNGNLDVPPPAPANFIRPGKRPLSSMSPTIVLKDGKVKAAVGASGGANIIAG 468
42573241  389 GYFGALMLSPSTGIVLNNEMDDFSIPMKSNGNLDVPPPAPANFIRPGKRPLSSMSPTIVLKDGKVKAAVGASGGANIIAG 468
224081230 426 SYFGTQILSPSTGIVLNNEMDDFSMPGNNTG--HVPPPAPLNLIRPGKRPLSSMTPTIVLKDEQLKGVVGASGGSMIIAG 503
224055697 366 AYFGSNILSPSTGILLNNEMDEFSIPMNNG---DVPPPAPPNSIRPGKRPLSSMTPTIILKDEKLKAVVGASGGAMIIAG 442
297797976 389 GYFGALMLSPSTGIVLNNEMDDFSIPMKSNGNLDVPPPAPANFIRPGKRPLSSMSPTIVLKDGKVKAAVGASGGANIIAG 468
297797978 395 GYFGAIMLSPSTGIVLNNEMDDFSIPMKSGGGPDVPPPAPANFIRPGKRPLSSMTPTIVLKDGKVKAALGASGGMFIIAG 474
297602847     --------------------------------------------------------------------------------    
79501722  475 TTQVYLNHFFLNMDPLSSVVAPRIYHQ---------------LIPNKASYENWTTVYSDHFEIPEEIRLVLEKKGQVLTP 539
22329258  469 TTEVYLNHFFLKMDPLSSVLAPRIYHQ---------------LIPNRASYENWTTVFNDHFEIPKATRVVLEKKGHVLSP 533
42573241  469 TTEVYLNHFFLKMDPLSSVLAPRIYHQ---------------LIPNRASYENWTTVFNDHFEIPKATRVVLEKKGHVLSP 533
224081230 504 TTEVLLNHFAKGMDPLSSVLAPRVYHQvymqftplgmacrflLTPNVVQYENWTTVYGDHFELSADVRAFLQKRGHVLKG 583
224055697 443 TTEVILNHL-RGMDPLHSVLAPRVYHQ---------------LIPNVVQYENWTTPYGEHYEVPANVRTFLRKRGHVLQS 506
297797976 469 TTEVYLNHFFLKMDPFSSVLAPRIYHQ---------------LIPNRVSYENWTTVFNDHFEIPKATRVVLEKKGHVLSP 533
297797978 475 TTEVYLNHFFLNMDPLSSVVAPRIYHQ---------------LIPNKASYENWTTVYNDHFEIPEETRLVLEKKGHVLMP 539
297602847     --------------------------------------------------------------------------------    
79501722  540 IAGGTISQLIVE--QSDGKSGGISKLVAVSDPRKGGFPSGY 578
22329258  534 IAGGTIAQFIVQ--ESGENSGGRSELVAVSDPRKGGFPSGY 572
42573241  534 IAGGTIAQFIVQ--ESGENSGGRSELVAVSDPRKGGFPSGY 572
224081230 584 IAGGTICQFIVQdlETTEGNKLMGKLVAVSDPRKGGLPAGY 624
224055697 507 LAGGSICQFIFVdaETSRKNKGRGELVGVSDPRKGGFPAGY 547
297797976 534 IAGGTIAQFIVQ--ESGRNSGGRSELVAVSDPRKGGFPSGY 572
297797978 540 IAGGTISQFIVE--ESDGSSGGMSKLVAVSDPRKGGFPSGY 578
297602847     -----------------------------------------    
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap