Conserved Protein Domain Family
PLN02197

?
PLN02197: PLN02197 
pectinesterase
Statistics
?
PSSM-Id: 177848
View PSSM: PLN02197
Aligned: 5 rows
Threshold Bit Score: 1094.28
Threshold Setting Gi: 297821114
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15226490    1 MIGKVVVSVASILLIVGVAIGVVAYINKNGDAN------LSPQMKAVRGICEATSDKASCVKTLEPVKSDDPNKLIKAFM 74 
15226482    1 MIGKVVVSVASILLIVGVAIGVVAFINKNGDAN------LSPQMKAVQGICQSTSDKASCVKTLEPVKSEDPNKLIKAFM 74 
15228697    2 AVGKVVVSVASLLLVVGVAIGVITFVNKGGGANgdsngpINSHQKAVQTICQSTTDQGSCAKTLDPVKSDDPSKLVKAFL 81 
297828439   1 MIGKVVVSVASILLIVGVAIGVVAFINKNGDAN------LSPQMKAVRGICEATSDKASCVKTLEPVKSDDPNKLIKAFM 74 
297821114   2 AVGKVVISVASLLLVVGVAIGVITYVNKGGGANgdsnapINSHQKAVQTICQSTTDQGSCAKTLEPVKSDDPSKLVKAFL 81 
15226490   75 LATRDAITQSSNFTGKTEGNLGSGISPNNKAVLDYCKKVFMYALEDLSTIVEEMGEDLNQIGSKIDQLKQWLTGVYNYQT 154
15226482   75 LATKDELTKSSNFTGQTEVNMGSSISPNNKAVLDYCKRVFMYALEDLATIIEEMGEDLSQIGSKIDQLKQWLIGVYNYQT 154
15228697   82 MATKDAITKSSNFTASTEGGMGTNMNATSKAVLDYCKRVLMYALEDLETIVEEMGEDLQQSGTKLDQLKQWLTGVFNYQT 161
297828439  75 LATRDALTTSSNFTGQTEVNMGSSISPNNKAVLDYCKRVFMYALEDLSTIVEEMGEDLNQIGSKIDQLKQWLIGVYNYQT 154
297821114  82 MATKDAITKSSNFTASTEGGMGTNMNATSKAVLDYCKKVLTYALEDLETIVEEMGEDLQQSGTKLDQLKQWLTGVFNYQT 161
15226490  155 DCLDDIEEDDLRKTIGEGIASSKILTSNAIDIFHTVVSAMAKLNLKVEDFKNMTGGIfapsdkgAAPvnkGTPPVADDSP 234
15226482  155 DCLDDIEEDDLRKAIGEGIANSKILTTNAIDIFHTVVSAMAKINNKVDDLKNMTGGI-------PTP---GAPPVVDESP 224
15228697  162 DCLDDIEEVELKKIMGEGISNSKVLTSNAIDIFHSVVTAMAQMGVKVDDMKNITMGA----------------------- 218
297828439 155 DCLDDIEEDDLRKTIGEGIANSKILTTNAIDIFHNVVSAMAKLNNKVDDFKNMTGGI-------PTPdnkGAPPVVDESP 227
297821114 162 DCLDDIEEVELKKIMGEGISNSKVLTSNAIDIFHSVVTAMAQMGVKVDDMKNISIGA----------------------- 218
15226490  235 VADPDGPARRLLEDIDETGIPTWVSGADRKLMTKAGRGSN--------------DGGARIRATFVVAKDGSGQFKTVQQA 300
15226482  225 VADPDGPARRLLEDIDETGIPTWVSGADRKLMAKAGRGRRgg-----------rGGGARVRTNFVVAKDGSGQFKTVQQA 293
15228697  219 --GAGGAARRLLEDNDSKGLPKWFSGKDRKLMAKAGRGAPaggddg---igeggGGGGKIKATHVVAKDGSGQFKTISEA 293
297828439 228 VADPDGPARRLLEDIDETGIPTWVSGADRKLMAKAGRGGN--------------GGAVGSERPLWWLRTEADSLRRFNKP 293
297821114 219 -GASGAPARRLLEDTDAKGLPKWFSGKDRKLMAKAGRGAPaggaggddgigeggGGGGKIKATHVVAKDGSGQFKTISQA 297
15226490  301 VNACPEKNPGRCIIHIKAGIYREQVIIPKKKNNIFMFGDGARKTVISYNRSVKLSPGTTTSLSGTVQVESEGFMAKWIGF 380
15226482  294 VDACPENNRGRCIIYIKAGLYREQVIIPKKKNNIFMFGDGARKTVISYNRSVALSRGTTTSLSATVQVESEGFMAKWMGF 373
15228697  294 VMACPDKNPGRCIIHIKAGIYNEQVRIPKKKNNIFMFGDGATQTIITFDRSVKLSPGTTTSLSGTVQVESEGFMAKWIGF 373
297828439 294 L-----------MLVLRITQADASSTSRLKKNNIFMFGDGARKTVISYNRSVALSRGTTTSLSATVQVESEGFMAKWLGF 362
297821114 298 VMACPDKNPGRCIIHIKAGIYNEQVTIPKKKNNIFMFGDGATQTIITFNRSVKLSPGTTTSLSGTVQVESEGFMAKWIGF 377
15226490  381 KNTAGPMGHQAVAIRVNGDRAVIFNCRFDGYQDTLYVNNGRQFYRNIVVSGTVDFIFGKSATVIQNSLIVVRKGNKGQFN 460
15226482  374 KNTAGPMGHQAAAIRVNGDRAVIFNCRFDGYQDTLYVNNGRQFYRNCVVSGTVDFIFGKSATVIQNTLIVVRKGSKGQYN 453
15228697  374 KNTAGPLGHQAVALRVNGDRAVIFNCRFDGYQDTLYVNNGRQFYRNIVVSGTVDFIFGKSATVIQNSLILVRKGSPGQSN 453
297828439 363 KNTAGPMGHQAAAIRVNGDRAVIFNCRFDGYQDTLYVNNGRQFYRNCVVSGTVDFIFGKSATVIQNTLIVVRKGSKGQYN 442
297821114 378 KNTAGPLGHQAVALRVNGDRAVIFNCRFDGYQDTLYVNNGRQFYRNIVVSGTVDFIFGKSATVIQNSLILVRKGSPGQSN 457
15226490  461 TVTADGNEKGLAMKIGIVLQNCRIVPDKKLAAERLIVESYLGRPWKKFSTTVIINSEIGDVIRPEGWKIWDGESFHKSCR 540
15226482  454 TVTADGNELGLGMKIGIVLQNCRIVPDRKLTPERLTVATYLGRPWKKFSTTVIMSTEMGDLIRPEGWKIWDGESFHKSCR 533
15228697  454 YVTADGNEKGAAMKIGIVLHNCRIIPDKELEADKLTIKSYLGRPWKKFATTVIIGTEIGDLIKPEGWTEWQGEQNHKTAK 533
297828439 443 TVTADGNELGLGMKLGIVLQNCRIVPDRKLTPERLTVATYLGRPWKKFSTTVIMSTEMGDLIRPEGWRIWDGENYHMSCR 522
297821114 458 YVTADGNEKGAAMKIGIVLHNCRIIPDKELEADKLTIKSFLGRPWKKFATTVIIGTEIGDLIKPEGWTEWQGEQNHKTAK 537
15226490  541 YVEYNNRGPGAITNRRVNWVKIARSAAEVNDFTVANWLGPINWIQEANVPVTLGL 595
15226482  534 YVEYNNRGPGAFANRRVNWAKVARSAAEVNGFTAANWLGPINWIQEANVPVTIGL 588
15228697  534 YIEFNNRGPGAATTQRPPWVKVAKSAAEVETYTVANWVGPANWIQEANVPVQLGL 588
297828439 523 YVEYNNRGPGAFTNRRVNWAKVARSAGEVNGFTVANWLGPIYWIQQANVPVTIGL 577
297821114 538 YIEFNNRGPGAATTQRPPWVKVAKSAAEVEAYTVANWVGPANWIQEANVPVQLGL 592
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap