Conserved Protein Domain Family
PLN02196

?
PLN02196: PLN02196 
abscisic acid 8'-hydroxylase
Statistics
?
PSSM-Id: 177847
View PSSM: PLN02196
Aligned: 9 rows
Threshold Bit Score: 950.53
Threshold Setting Gi: 255555535
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
224129948   1 MEFSpSVFFLSFASILLLVggllFKSLLKFFASDRPQSLPLPPGTMGWPYMGETFQLYSQDPNVFFASKRKRYGSIFKTH 80 
42572955    1 MDIS-ALFLTLFAGSLFLY----FLRCLISQRRFGSSKLPLPPGTMGWPYVGETFQLYSQDPNVFFQSKQKRYGSVFKTH 75 
18415271    1 MDIS-ALFLTLFAGSLFLY----FLRCLISQRRFGSSKLPLPPGTMGWPYVGETFQLYSQDPNVFFQSKQKRYGSVFKTH 75 
255555535   1 MDFF-AFFFLLFLSISFVFllisLLNFF--FPSNSSAKLPLPPGSLGWPYIGETFQLYSQNPNVFFASKQKRYGSVFKTH 77 
225427617   1 MDSS--FTTICFSIALLLFlihfLLKLFSFFSASTARKLPLPPGSLGWPYIGETFQLYSQNPNVFFASKQERYGTIFKTH 78 
30694740    1 MDFS-GLFLTLSAAALFLC----LLRFIAGVRRSSSTKLPLPPGTMGYPYVGETFQLYSQDPNVFFAAKQRRYGSVFKTH 75 
30694744    1 MDFS-GLFLTLSAAALFLC----LLRFIAGVRRSSSTKLPLPPGTMGYPYVGETFQLYSQDPNVFFAAKQRRYGSVFKTH 75 
297804218   1 MDFS-ALFLTLLAGSLFLY----FLRCLISQRRLGSSKLPLPPGTMGWPYVGETFQLYSQDPNVFFQTKQRRYGSVFKTH 75 
297791207   1 MDFS-DLFLTLFAVALFLC----LLRFIAGIRRSSSTNLPLPPGTMGYPYVGETFQLYSQDPNVFFAAKQRRYGSVFKTH 75 
224129948  81 ILGCPCVMISSPEAAKFVLVTKSHLFKPTFPASKERMLGKEAIFFHQGAYHMKLRKLVLRAFLPEAIKNIVPDIQNIAKD 160
42572955   76 VLGCPCVMISSPEAAKFVLVTKSHLFKPTFPASKERMLGKQAIFFHQGDYHAKLRKLVLRAFMPESIRNMVPDIESIAQD 155
18415271   76 VLGCPCVMISSPEAAKFVLVTKSHLFKPTFPASKERMLGKQAIFFHQGDYHAKLRKLVLRAFMPESIRNMVPDIESIAQD 155
255555535  78 ILGCPCVMISSPEAARFVLVSKAHLFKPTFPASKERMLGKQAIFFHQGDYHNKLRKLVLRAFVPDAIKSIVSDIESIAKE 157
225427617  79 ILGCPCVMISSPEAAKLVLVTKAPLFKPTFPASKERMLGKQAIFFHQGDYHAKLRKLVLRAFMPGAIKNIVSNIDSIATQ 158
30694740   76 VLGCPCVMISSPEAAKFVLVTKSHLFKPTFPASKERMLGKQAIFFHQGDYHSKLRKLVLRAFMPDAIRNMVPHIESIAQE 155
30694744   76 VLGCPCVMISSPEAAKFVLVTKSHLFKPTFPASKERMLGKQAIFFHQGDYHSKLRKLVLRAFMPDAIRNMVPHIESIAQE 155
297804218  76 VLGCPCVMISSPEAAKFVLVTKSHLFKPTFPASKERMLGKQAIFFHQGDYHAKLRKLVLRAFMPESIRNMVPDIESIAQD 155
297791207  76 VLGCPCVMISSPEAAKFVLVTKSHLFKPTFPASKERMLGKQAIFFHQGDYHSKLRKLVLRAFMPDAIRNMVPHIESIAQE 155
224129948 161 SLQYWEGRLINTFQEMKSYTFNVALLSIFGKDEVLYREDLKRCYYILEKGYNSMPINLPGTLFNKSMKARKELARILAKI 240
42572955  156 SLRSWEGTMINTYQEMKTYTFNVALLSIFGKDEVLYREDLKRCYYILEKGYNSMPVNLPGTLFHKSMKARKELSQILARI 235
18415271  156 SLRSWEGTMINTYQEMKTYTFNVALLSIFGKDEVLYREDLKRCYYILEKGYNSMPVNLPGTLFHKSMKARKELSQILARI 235
255555535 158 SVHSWEGRDINTFQEMKTYAFNVALLSIFGKDEFQYREELKRCYYILEKGYNSMPINLPGTLFHKAMKARKELAQILAKT 237
225427617 159 TLQSWEGRSINTFQEMKTYTFNVALLSIFGKDEILYREELKKCYYILEKGYNSMPINIPGTLFNKSMKARKELAQILAKI 238
30694740  156 SLNSWDGTQLNTYQEMKTYTFNVALISILGKDEVYYREDLKRCYYILEKGYNSMPINLPGTLFHKAMKARKELAQILANI 235
30694744  156 SLNSWDGTQLNTYQEMKTYTFNVALISILGKDEVYYREDLKRCYYILEKGYNSMPINLPGTLFHKAMKARKELAQILANI 235
297804218 156 SLRIWEGTMINTYQEMKTYTFNVALLSIFGKDEVLYREDLKRCYYILEKGYNSMPVNLPGTLFHKSMKARKELSQILARI 235
297791207 156 SLNSWDGTQLNTYQEMKTYTFNVALISILGKDEVFYREDLKRCYYILEKGYNSMPINLPGTLFHKAMKARKELAQILANI 235
224129948 241 LSTRRQMKLDHNDLLGSFMGDKEGLTDDQIADNIIGVIFAARDTTASVLTWILKYLGENPSVLQAVTEEQEAIMRSEEkg 320
42572955  236 LSERRQNGSSHNDLLGSFMGDKEELTDEQIADNIIGVIFAARDTTASVMSWILKYLAENPNVLEAVTEEQMAIRKDKE-- 313
18415271  236 LSERRQNGSSHNDLLGSFMGDKEELTDEQIADNIIGVIFAARDTTASVMSWILKYLAENPNVLEAVTEEQMAIRKDKE-- 313
255555535 238 LSSRRQMKLDRNDLLGSFMEDKEGLSDEQIADNIIGVIFAARDTTASVLTWILKYLGENPSVLQAVTEEQEEIVRSKEks 317
225427617 239 LSTRRQANGDHNDLLGSFMGDKEGLTDEQIADNIIGVIFAARDTTASVLTWILKYLGENPSVLQAVTEEQESIMRSKEdk 318
30694740  236 LSKRRQNPSSHTDLLGSFMEDKAGLTDEQIADNIIGVIFAARDTTASVLTWILKYLADNPTVLEAVTEEQMAIRKDKK-- 313
30694744  236 LSKRRQNPSSHTDLLGSFMEDKAGLTDEQIADNIIGVIFAARDTTASVLTWILKYLADNPTVLEAVTEEQMAIRKDKK-- 313
297804218 236 LSERRQNGSPHNDLLGSFMGDKEELTDEQIADNIIGVIFAARDTTASVMSWILKYLAENPNVLEAVTEEQMAIRTDKE-- 313
297791207 236 LSKRRQNSSSHTDLLGSFMEDKEGLSDEQIASSHTGFIFAARDTTASVLTWILKYLADNPTVLEEKKEEQMAIRKDKK-- 313
224129948 321 -dEEKLLTWADTKKMPITSRVIQETLRVASILSFTFREAVEDVEYEGYLIPKGWKVLPLFRNIHHSPELFPDPEKFDPSR 399
42572955  314 --EGESLTWGDTKKMPLTSRVIQETLRVASILSFTFREAVEDVEYEGYLIPKGWKVLPLFRNIHHSADIFSNPGKFDPSR 391
18415271  314 --EGESLTWGDTKKMPLTSRVIQETLRVASILSFTFREAVEDVEYEGYLIPKGWKVLPLFRNIHHSADIFSNPGKFDPSR 391
255555535 318 -gEQKVLSWADTKKMPVTSRVIQETLRVASILSFTFREAVEDVEYEGYLIPKGWKVLPLFRNIHHSPEIFPDPEKFDPSR 396
225427617 319 cgEEKSLTWEDAKKMPITSRVIQETLRIASILSFTFREAVEDVEFEGYLIPKGWKVLPLFRNIHHSPDIYPEPEKFDPSR 398
30694740  314 --EGESLTWEDTKKMPLTYRVIQETLRAATILSFTFREAVEDVEYEGYLIPKGWKVLPLFRNIHHNADIFSDPGKFDPSR 391
30694744  314 --EGESLTWEDTKKMPLTYRVIQETLRAATILSFTFREAVEDVEYEGYLIPKGWKVLPLFRNIHHNADIFSDPGKFDPSR 391
297804218 314 --EGEALTWGDTKKMPLTSRVIQETLRVASILSFTFREAVEDVEYEGYLIPKGWKVLPLFRNIHHSADIFSNPGKFDPSR 391
297791207 314 --EGESLTWEDTKKMPLTYRVIQETLRAATILSFTFREAVEDVEYEGYLIPKGWKVLPLFRNIHHNADIFSDPGKFDPSR 391
224129948 400 FEVAPKPNTFMPFGNGTHSCPGNELAKVEILVLLHHLTTKYRW-SIVGANNGIQYGPFALPQNGLPIILSHKS 471
42572955  392 FEVAPKPNTFMPFGNGTHSCPGNELAKLEMSIMIHHLTTKYRFgQLLERATGFSMGHSRFPKTDCPLCWPGSR 464
18415271  392 FEVAPKPNTFMPFGNGTHSCPGNELAKLEMSIMIHHLTTKYSW-SIVGASDGIQYGPFALPQNGLPIVLARKP 463
255555535 397 FEVAPKPNTFMPFGNGTHSCPGNELAKLEILVLLHHLTTKYRW-TMVSTDNGIQYGPFALPQNGLPIKLSQKS 468
225427617 399 FEVAPKPNTFMPFGNGVHSCPGNELAKLEILVLLHHLTTKYRW-SMVGTQNGIQYGPFALPQNGLPITISLNF 470
30694740  392 FEVAPKPNTFMPFGSGIHSCPGNELAKLEISVLIHHLTTKYRW-SIVGPSDGIQYGPFALPQNGLPIALERKP 463
30694744  392 FEVAPKPNTFMPFGSGIHSCPGNELAKLEISVLIHHLTTKYRLvHLQNDNSPFGN------------------ 446
297804218 392 FEVAPKPNTFMPFGNGTHSCPGNELAKLEMSIMIHHLTTKYRFgQLLERATGFSMGHSRFPKTDCPLCWPGSR 464
297791207 392 FEVAPKPNTFMPFGSGIHSCPGNELAKLEISVLIHHLTTKYRW-SIVGPSDGIQYGPFALPQNGLPIALERKP 463
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap