Conserved Protein Domain Family
PLN02194

?
PLN02194: PLN02194 
cytochrome-c oxidase
Statistics
?
PSSM-Id: 177845
View PSSM: PLN02194
Aligned: 2 rows
Threshold Bit Score: 462.21
Threshold Setting Gi: 15226079
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15226079    1 MIESQRHSYHLVDPSPWPISGSLGALATTVGGVMYMHPFQGGARLLSLGLIFILYTMFVWWRDVLRESTLEGHHTKVVQL 80 
297818670   1 MIESQRHSYHLVDPSPWPISGSLGALATTVGGVMYMHPFQGGARLLSLGLIFLLYTMFVWWRDVLRESTLEGHHTKVVQL 80 
15226079   81 GPRYGSILFIVSEVMFFFAFFWASSHSSLAPAVEIGGIWPPKGIEVLDPWEIPFLNTPILPSSGAAVTWAHHAILAGKEK 160
297818670  81 GPRYGSILFIVSEVMFFFAFFWASSHSSLAPAVEIGGIWPPKGIGVLDPWEIPFLNTPILPSSGAAVTWAHHAILAGKEK 160
15226079  161 RAVYALVATVLLALVFTGFQGMEYYQAPFTISDSIYGSTFFLATGFHGFHVIIGTLFLIICGIRQYLGHLTKEHHVGFEA 240
297818670 161 RAVYALVATVLLALVFTGFQGMEYYQAPFTISDSIYGSTFFLATGFHGFHVIIGTLFLIICGIRQYLGHLTKEHHVGFEA 240
15226079  241 AAWYWHFVDVVWLFLFVSIYWWGGI 265
297818670 241 AAWYWHFVDVVWLFLFVSIYWWGGI 265
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap