Conserved Protein Domain Family
PLN02193

?
PLN02193: PLN02193 
nitrile-specifier protein
Statistics
?
PSSM-Id: 177844
View PSSM: PLN02193
Aligned: 10 rows
Threshold Bit Score: 952.091
Threshold Setting Gi: 297826753
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15225787    1 MVQKVEARGGEIGDVWDDGAYDGVRKVYVGQGEDGIAFVKFEYVNGSQEVVGDERGKKTLLGAEEFEVDPDDYIVYVEGY 80 
15228197  150 NAKKLEAKGGDTGDIWDDGVYDNVRKVYVGQAQYGIAFVKFEYVNGSQVVVGDEHGKKTELGVEEFEIDADDYIVYVEGY 229
18401112    1 MAQKLVAQGGETGDVWDDGVYDNVTKVYVGQGQYGIAFVKFEYANGSEVVVGDEHGEKTELGVEEFEIDSDDYIVYVEGY 80 
18401116    1 MAQKLEAKGGEMGDVWDDGVYENVRKVYVGQAQYGIAFVKFEYVNGSQVVVGDEHGKKTELGVEEFEIDADDYIVYVEGY 80 
79324051    1 MVQKVEARGGEIGDVWDDGAYDGVRKVYVGQGEDGIAFVKFEYVNGSQEVVGDERGKKTLLGAEEFEVDPDDYIVYVEGY 80 
79313259    1 MAQKLEAKGGEMGDVWDDGVYENVRKVYVGQAQYGIAFVKFEYVNGSQVVVGDEHGKKTELGVEEFEIDADDYIVYVEGY 80 
297826753   1 MAQKVEAKGGEIGDVWDDGSYDGVRKVYVGQGEDGIAFVKFEYVNGSQVVVGDERGKKTLLGAEEFEVDADDYIVYVEGY 80 
297830244   1 MAQKLEAKGGETGDVWDDGAYENVRKVYVGQGQYGIAFVKFEYFNGSQVVVGDEHGKKTELGVEEFEIDADDYIVYVEGY 80 
297834516   1 MAKKLEAKGGETGDVWDDVVYDNVRKVYVGQGQYGIAFVKFEYVNGSQVVVGDEHGTKTKLGVDEFEIDADDYIVYVEGY 80 
297789101   1 MAQKVEAKGGEIGDVWDDGSYDGVRKVYVGQGEDGIAFVKFEYVNGSQVVVGDERGKKTLLGAEEFEVDADDYIVYVEGY 80 
15225787   81 HEKVFGVTTkEIISTLTFKTYKGKTSPPFGIVSGTKFVLQGGKIVGFHGRSTDVLHSLGAYISSPAT----------PKL 150
15228197  230 REKVNGMTS-EMITFLSFKTYKGKTSQPIEQRPGIKFVLQGGKIVGFHGRSTDVLDSLGAYISLSPT----------PNL 298
18401112   81 REKVSDMTS-EMITFLSFKTSKGKTSQPIVKKPGVKFVLHGGKIVGFHGRSTDVLHSLGAYVSLPST----------PKL 149
18401116   81 REKVNDMTS-EMITFLSIKTFKGKTSHPIEKRPGVKFVLHGGKIVGFHGRSTDVLHSLGAYVSLSST----------IKL 149
79324051   81 HEKVFGVTTkEIISTLTFKTYKGKTSPPFGIVSGTKFVLQGGKIVGFHGRSTDVLHSLGAYISSPAT----------PKL 150
79313259   81 REKVNDMTS-EMITFLSIKTFKGKTSHPIEKRPGVKFVLHGGKIVGFHGRSTDVLHSLGAYVSLSST----------IKL 149
297826753  81 HEKVFGVSTkEIISTLTFKTYKGKTSPPFGIVSGTKFVLQGGKIVGFHGRSTDVLHSLGAYISLPST----------PKL 150
297830244  81 REKVNDMTS-EIITFLSIKTFKGKTSHPIEKRPGVKFVLHGGKIVGFHGRSTVYTLSGPMFLCRPLPnyleiilfllPPQ 159
297834516  81 SEKVNDMTS-EMITFLSFKTFTGKTSHPIKKRPGVKFVLQGGKVVGFHGRSTDVLHSLGAYVSLSST----------PKL 149
297789101  81 HEKVFGVSTkEIISTLTFKTYKGKTSPPFGIVSGTKFVLQGGKIVGFHGRSTDVLHSLGAYISLPST----------PKL 150
15225787  151 RGKWIKVEQKGEGPGPRCSHDIAQVGNKIFSFGGELTPNQPIDKHLYVFDLETRTWSISPATGDVPNLSCLGVRMVSIGS 230
15228197  299 HGKWTKVDENGDGPGLRCSHDIAQVGNKIYSFGGEFTPNQPIDKHLYVFDIESRTWSISPATGDIPTLSCLGVCMVSIGS 378
18401112  150 LGNWIKVEQNGEGPGLRCSHGIAQVGNKIYSFGGELIPNQPIDKHLYVFDLETRTWSIAPATGDVPHLSCLGVRMVSVGS 229
18401116  150 LGKWIKVEQKGEGPGLRCSHGIAQVGNKIYSFGGEFTPNQPIDKHLYVFDLETRTWSISPATGDVPHLSCLGVRMVSVGS 229
79324051  151 RGKWIKVEQKGEGPGPRCSHDIAQVGNKIFSFGGELTPNQPIDKHLYVFDLETRTWSISPATGDVPNLSCLGVRMVSIGS 230
79313259  150 LGKWIKVEQKGEGPGLRCSHGIAQVGNKIYSFGGEFTPNQPIDKHLYVFDLETRTWSISPATGDVPHLSCLGVRMVSVGS 229
297826753 151 RGKWIKVEQKGEGPGPRCSHDIAQVGNKIYSFGGELTPNQPIDKHLYVFDLETRTWSISPATGDVPNLSCLGVRMVSIGS 230
297830244 160 ITKSRTVEQKGEGPGLRCSHGIAQVGNKIYSFGGEFTPNQPIDKHLYVFDLETRTWSISPATGDVPHLSCLGVRMVSVGS 239
297834516 150 LGNWIKVEENGEGPGLRCSHGIAQIGNKIYSFGGEFTPNQPIDKHLYVFDLETRTWSISPATGDVPHLSCLGVRMVSIGS 229
297789101 151 RGKWIKVEQKGEGPGPRCSHDIAQVGNKIYSFGGELTPNQPIDKHLYVFDLETRTWSISPATGDVPNLSCLGVRMVSIGS 230
15225787  231 SLYVFGGRDASRKYNGFYSFDTTKNEWKLLTPVEQGPTPRSFHSMTADENNVYVFGGVSATVRLKTLDAYNIVDHKWVQC 310
15228197  379 TLYVFGGRDASRQYNGFYSFDTTTNEWKLLTPVEEGPTPRSFHSMAADEENVYVFGGVSATARLNTLDSYNIVDKKWFHC 458
18401112  230 TLYTFGGRDFSRQYNGFYSFDTTTNEWKLLTPVEEGPTPRSFHSMAADEENVYVFGGVGAMDRIKTLDSYNIVDKTWFHC 309
18401116  230 TLYVFGGRDASRQYNGFYSFDTTTNEWKLLTPVEEGPTPRSFHSMAADEENVYVFGGVSATARLNTLDSYNIVDKKWFHC 309
79324051  231 SLYVFGGRDASRKYNGFYSFDTTKNEWKLLTPVEQGPTPRSFHSMTADENNVYVFGGVSATVRLKTLDAYNIVDHKWVQC 310
79313259  230 TLYVFGGRDASRQYNGFYSFDTTTNEWKLLTPVEEGPTPRSFHSMAADEENVYVFGGVSATARLNTLDSYNIVDKKWFHC 309
297826753 231 SLYVFGGRDASRKYNGFYSFDTIKNEWKLLTPVEQGPTPRSFHSMAADEKNVYVFGGVSATVRLKTLDAYNIVDHKWVQC 310
297830244 240 TLYVFGGRDASRQYNGFYSFDTTTHVWKLLTPVEEGPTPRSFHSMAADEENVYVFGGVSATARLKTLDSYNIVDKKWFHC 319
297834516 230 TLYVFGGRDASRQYNGFYSFDTTTNEWKLLTPVEEGPTPRSFHSMAADEENVYVFGGVGARERIKTLDSYNIVDKKWFHC 309
297789101 231 SLYVFGGRDASRKYNGFYSFDTIKNEWKLLTPVEQGPTPRSFHSMAADEKNVYVFGGVSATVRLKTLDAYNIVDHKWVQC 310
15225787  311 STPGGSCSVRGGAGLEVVQGKVWVVYGFNGCEVDDVHCYDPAQDKWTQVETFGEKPCARSVFASAVVGKHILVFGGEIAM 390
15228197  459 STPGDSLTARGGAGLEVVQGKVWVVYGFNGCEVDDVHYYDPVQDKWTQVETFGVRPSERSVFASAALGKHIVIFGGEIAM 538
18401112  310 SNPGDSFSIRGGAGLEVVQGKVWIVYGFNGCEVDDVHFYDPAEDKWTQVETFGVKPNERSVFASAAIGKHIVIFGGEIAM 389
18401116  310 STPGDSLTARGGAGLEVVQGKVWVVYGFNGCEVDDVHYYDPVQDKWTQVETFGVRPSERSVFASAAIGKHIVIFGGEIAM 389
79324051  311 STPGGSCSVRGGAGLEVVQGKVWVVYGFNGCEVDDVHCYDPAQDKWTQVETFGEKPCARSVFASAVVGKHILVFGGEIAM 390
79313259  310 STPGDSLTARGGAGLEVVQGKVWVVYGFNGCEVDDVHYYDPVQDKWTQVETFGVRPSERSVFASAAIGKHIVIFGGEIAM 389
297826753 311 STPGGSFSIRGGAGLEVVQGKVWVVYGFNGCEVDDVHCYDPVQDKWTQVETFGEKPCARSVFASAVVGKYLLIFGGEIAM 390
297830244 320 STPLESLTARGGAGLEVVQGKVWVVYGFNGCEVDDVYYYDPVQDKWAQVETFGVRPSERSVFASAAVGKHIVLFGGEIAM 399
297834516 310 STPGDSFSIRGGAGLEVVQGKVWVVYGFNGCEIDDVHFYDPAEDSWTRVETFGVRPSERSVFASAALGKHIVMFGGEIAM 389
297789101 311 STPGGSFSIRGGAGLEVVQGKVWVVYGFNGCEVDDVHCYDPVQDKWTQVETFGEKPCARSVFASAVVGKYLLIFGGEIAM 390
15225787  391 DPKAHEGPGQLSGGTFALDTETLKWEKLDKLGEEEETPSIRGWSASTTGTIDGKKGLVMFGGKAQTNDRFGDLFFYGVDS 470
15228197  539 DPLAHVGPGQLTDGTFALDTETLQWERLDKFGGEEETPSSRGWTASTTATIGGKKGLVMHGGKAPTNDRFDDLFFYGIDS 618
18401112  390 DPRAHVGPGQLIDGTFALDTETLQWERLDKF---EGTPSSRGWTASTTGTIDGKKGLVMHGGKAPTNDRFDDLFFYGIDS 466
18401116  390 DPLAHVGPGQLTDGTFALDTETLQWERLDKFGGEEETPSSRGWTASTTATIDGKKGLVMHGGKAPTNDRFDDLFFYGIDS 469
79324051  391 DPKAHEGPGQLSGGTFALDTETLKWEKLDKLGEEEETPSIRGWSASTTGTIDGKKGLVMFGGKAQTNDRFGDLFFYGVDS 470
79313259  390 DPLAHVGPGQLTDGTFALDTETLQWERLDKFGGEEETPSSRGWTASTTATIDGKKGLVMHGGKAPTNDRFDDLFFYGIDS 469
297826753 391 DPKAHEGPGQLSGGTFAFDTETLKWEKLDKFGEEEETPSIRGWSASTTGTIDGKKGLVMLGGKAQTNDRFGDLFFYGVDS 470
297830244 400 DPLAHVGPGQLTDGTFALDTETLQWERLDKLGEEEETPSSRGWTASTTGTIDGKKGLVMHGGKAPTNDRFDDLFFYGIDS 479
297834516 390 DPLAHVGPGQLIDGTFTLDTETLQWERLDKFG-EEETPSSRGWTASTTGTIDGKKGLVMHGGKAPTNDRFDDLFFYGIDS 468
297789101 391 DPKAHEGPGQLSGGTFAFDTETLKWEKLDKFGEEEETPSIRGWSASTTGTIDGKKGLVMLGGKAQTNDRFGDLFFYGVDS 470
15225787  471 A 471
15228197  619 A 619
18401112  467 V 467
18401116  470 A 470
79324051  471 A 471
79313259  470 A 470
297826753 471 A 471
297830244 480 V 480
297834516 469 V 469
297789101 471 A 471
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap