Conserved Protein Domain Family
PLN02191

?
PLN02191: PLN02191 
L-ascorbate oxidase
Statistics
?
PSSM-Id: 177843
View PSSM: PLN02191
Aligned: 3 rows
Threshold Bit Score: 1246.06
Threshold Setting Gi: 15242154
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
240256322  15 SQMGVWWIVLVVAVLTHTASAAVREYHWEVEYKYWSPDCKEGAVMTVNGEFPGPTIKAFAGDTIVVNLTNKLTTEGLVIH 94 
15242154    1 MAVIVWWLLTVVVVAFHSASAAVVESTWEVEYKYWWPDCKEGIVMAINGQFPGPTIDAVAGDTVIIHVVNKLSTEGVVIH 80 
297808167   1 --MVVWWIV-VVAVLTHTASAAVREYDWEVEYKFWQPDCKEGAVMTVNGQFPGPTIQAVAGDTIVVHLTNKLTTEGLVIH 77 
240256322  95 WHGIRQFGSPWADGAAGVTQCAINPGETFTYNFTVEKPGTHFYHGHYGMQRSAGLYGSLIVdvaKGKSERLRYDGEFNLL 174
15242154   81 WHGIRQKGTPWADGAAGVTQCPINPGETFTYKFIVDKAGTHFYHGHYGMQRSSGLYGMLIV---RSPKERLIYDGEFNLL 157
297808167  78 WHGIRQLGSPWADGAAGVTQCAINPGETFTYKFTVEKPGTHFYHGHYGMQRSAGLYGSLIVdvaKGQRERLRYDGEFNLL 157
240256322 175 LSDWWHEAIPSQELGLSSKPMRWIGEAQSILINGRGQFNCSLAAQFSNNTSLPMCTFKEGDQCAPQILHVEPNKTYRIRL 254
15242154  158 LSDWWHQSIHAQELALSSRPMRWIGEPQSLLINGRGQFNCSQAAYFNKGGEKDVCTFKENDQCAPQTLRVEPNRVYRLRI 237
297808167 158 LSDWWHEPIPSQELGLSSKPMRWIGEAQSILINGRGQFNCSLAAQFSN-TTLPMCTFKEGDQCAPQKLNVEPNKTYRIRL 236
240256322 255 SSTTALASLNLAVQGHKLVVVEADGNYITPFTTDDIDIYSGESYSVLLTTDQDPSQNYYISVGVRGRKPNTTQALTILNY 334
15242154  238 ASTTALASLNLAVQGHQLVVVEADGNYVAPFTVNDIDVYSGETYSVLLKTNALPSKKYWISVGVRGREPKTPQALTVINY 317
297808167 237 ASTTALASLNLAVQGHKLVVVEADGNYITPFITDDIDIYSGESYSVLLTTDQDPSQNYYISVGVRGRKPNTTQALTILNY 316
240256322 335 VTAPASKlPSSPPPVTPRWDDFERSKNFSKKIFSAMGSPSPPKKYRKRLILLNTQNLIDGYTKWAINNVSLVTPATPYLG 414
15242154  318 VDATESR-PSHPPPVTPIWNDTDRSKSFSKKIFAAKGYPKPPEKSHDQLILLNTQNLYEDYTKWSINNVSLSVPVTPYLG 396
297808167 317 VTAPASKlPSSPPPVTPRWDDFERSKNFSKKIFSAMGSPSPPKKYRKRLILLNTQNLIDGYTKWAINNVSLVTPATPYLG 396
240256322 415 SVKYNLKLGFNRKSPPRSYRMD-YDIMNPPPFPNTTTGNGIYVFPFNVTVDVIIQNANVLKGIVSEIHPWHLHGHDFWVL 493
15242154  397 SIRYGLKSAYDLKSPAKKLIMDnYDIMKPPPNPNTTKGSGIYNFAFGIVVDVILQNANVLKGVISEIHPWHIHGHDFWVL 476
297808167 397 SVKYNLKLGFNRKSPPRSYRMD-YDIMNPPPFPNTTTGNGIYVFPFNVTVDVIIQNANVLKGVVSEIHPWHLHGHDFWVL 475
240256322 494 GYGDGKFKPGIDEKTYNLKNPPLRNTAILYPYGWTAIRFVTDNPGVWFFHCHIEPHLHMGMGVVFAEGLNRIGK--VPDE 571
15242154  477 GYGEGKFKPGIDEKTFNLKNPPLRNTVVLYPFGWTAIRFVTDNPGVWFFHCHIEPHLHMGMGVVFVEGVDRIGKmeIPDE 556
297808167 476 GYGDGKFKPGIDEKTYNLKNPPLRNTAILYPYGWTALRFVTDNPGVWFFHCHIEPHLHMGMGVVFAEGLNRIGK--IPDE 553
240256322 572 ALGCGLTKQFLMNRNRN 588
15242154  557 ALGCGLTRKWLMNRGRP 573
297808167 554 ALGCGLTKQFLMNRNHN 570
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap