Conserved Protein Domain Family
PLN02183

?
PLN02183: PLN02183 
ferulate 5-hydroxylase
Statistics
?
PSSM-Id: 165828
View PSSM: PLN02183
Aligned: 9 rows
Threshold Bit Score: 963.542
Threshold Setting Gi: 225427752
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
224105309   1 MDSPLLQSLQSP----STLFILASLFVSLILWFLiRKKLPYPPGPKGYPIIGNLGMVDQLTHRGLASLSKRYGGLCHLQM 76 
15234332    1 MESSISQTLSKLsdptTSLVIVVSLFIFISFITR-RRRPPYPPGPRGWPIIGNMLMMDQLTHRGLANLAKKYGGLCHLRM 79 
224134158   1 ---------------mSFFLIIISSIFFLGLISRlRRRSPYPPGPKGFPLIGSMHLMDQLTHRGLAKLAKQYGGLFHMRM 65 
224134154   1 MDSLLQSLQTLPm---SFFLIIISSIFFLGLISRlRRRSPYPPGPKGFPLIGSMHLMDQLTHRGLAKLAKQYGGLFHMRM 77 
224094911   1 MDSLVQSLQASPm---SFFLIAITSLFFLGLLSRlRRRLPYPPGPKGLPLVGSMHMMDQITHRGLAKLAKQYGGLFHMRM 77 
225431217   1 MDSIMEGLQPLQ----MTLLFIIPLILLLGLVSRlRRRRPYPPGPKGLPLIGSMNMMDQLTHRGLAKIAKQYGGIFHLRM 76 
225427752   1 MASPLQSLLTFP----SLFFLLFSLFLFIIFLRNfSRKLPYPPGPKGLPIIGNMLMMNQLTHRGLANLSKVYGGLLHMKM 76 
225427746   1 MASPLQSLLTFP----SLFFLLFSLFLFIIFLRKlSRKLPYPPGPKGLPIIGNMLMMNQLTHRGLANLSKVYGGLLHMKM 76 
297798290   1 MESSISQTLSKVsdptTALLIVVSFFIFIGFITR-RRRPPYPPGPRGWPIIGNMLMMDQLTHRGLANLAKKYGGLCHLRM 79 
224105309  77 GGLHVVAVSTPEIAREVLQAQDVVFANRPANVAIVYLTYDRADMAFANYGPFWRQTRKICVMKLFSRKRAESWASVRDEV 156
15234332   80 GFLHMYAVSSPEVARQVLQVQDSVFSNRPATIAISYLTYDRADMAFAHYGPFWRQMRKVCVMKVFSRKRAESWASVRDEV 159
224134158  66 GYLHMVAVSSPEVARQVLQVQDNIFSNRPANIAISYLTYDRADMAFAHYGPFWRQMRKLCVMKLFSRKRAESWESVRDEV 145
224134154  78 GYLHMVAVSSPEVARQVLQVQDNIFSNRPANIAISYLTYDRADMAFAHYGPFWRQMRKLCVMKLFSRKRAESWESVRDEV 157
224094911  78 GYLHMVTVSSPEIARQVLQVQDNIFSNRPANIAIRYLTYDRADMAFAHYGPFWRQMRKLCVMKLFSRKRAESWESVRDEV 157
225431217  77 GYLHMVGVSSPDIARQVLQVQDNIFSNRPATIAISYLTYDRADMAFAHYGPFWRQMRKLCVMKLFSRKRAESWESVREEV 156
225427752  77 GVLHLVVVSTPEMAREVLQVQDSVFANRPARVAIKYLTYDRADMAFAQYGPSWRQMRKICVMKLFSRKRAESWASVREEV 156
225427746  77 GVLHLVVVSTPEMAREVLQVQDSVFANRPARVAIKYLTYDRADMAFAQYGPSWRQMRKICVMKLFSRKRAESWASVREEV 156
297798290  80 GFLHMYAVSSPDVARQVLQVQDSVFSNRPATIAISYLTYDRADMAFAHYGPFWRQMRKVCVMKVFSRKRAESWASVRDEV 159
224105309 157 EFTVRRVSEKTGEPVNIGELVFALTRSITYKAAFGSSSNEGQEEFMEILQEFSKLFGAFNVADFFPWLGWVNAQDFNKRL 236
15234332  160 DKMVRSVSCNVGKPINVGEQIFALTRNITYRAAFGSACEKGQDEFIRILQEFSKLFGAFNVADFIPYFGWIDPQGINKRL 239
224134158 146 DSMVKTVESNIGKPVNVGELIFTLTMNITYRAAFGAK-NEGQDEFIKILQEFSKLFGAFNISDFIPWLGWIDPQGLTARL 224
224134154 158 DSMVKTVESNIGKPVNVGELIFTLTMNITYRAAFGAK-NEGQDEFIKILQEFSKLFGAFNISDFIPWLGWIDPQGLTARL 236
224094911 158 DSMLKTVEANIGKPVNLGELIFTLTMNITYRAAFGAK-NEGQDEFIKILQEFSKLFGAFNMSDFIPWLGWIDPQGLSARL 236
225431217 157 ESTVRTVASSIGSPVNIGELVFTLTKNIIYRAAFGTSSKEGQDEFISILQEFSKLFGAFNIADFIPWLSWVDPQGLNARL 236
225427752 157 DSTLQSIAKRGGSAVNIGELALDLTKNITYRAAFGSSSREKQKEFVKILQEFSRLFGAFNFADFIPWLGWIQGKEFTKRL 236
225427746 157 DSTLQSIAKRGGSAVNIGELALDLTKNITYRAAFGSSSREKQEEFVKILQEFSRLFGAFNFADFIPWLGWIQGKEFNKRL 236
297798290 160 DKMVRSVSCNVGKPINVGEHIFALTRNITYRAAFGSACEKGQDEFIRILQEFSKLFGAFNVADFIPYFGWIDPQGINKRL 239
224105309 237 AKARNSLDGFIDTIIDEHIAKKNNTkslNAKDENEEVDSDMVDELLAFYSEDA-SKNDFDESRSTVKFNKDHIKALIMDV 315
15234332  240 VKARNDLDGFIDDIIDEHMKKKENQ---NAVDDGDVVDTDMVDDLLAFYSEEAkLVSETADLQNSIKLTRDNIKAIIMDV 316
224134158 225 VKARKALDKFIDHIIDDHIQKRKQN------NYSEEAETDMVDDMLTFYSEET-KVNESDDLQNAIKLTRDNIKAIIMDV 297
224134154 237 VKARKALDKFIDHIIDDHIQKRKQN------NYSEEAETDMVDDMLTFYSEET-KVNESDDLQNAIKLTRDNIKAIIMDV 309
224094911 237 VKARKALDKFIDSIIDDHIQKRKQN------NFSEDAETDMVDDMLAFYSEEArKVDESDDLQKAISLTKDNIKAIIMDV 310
225431217 237 AKARKSLDGFIDDIIDDHMQKKKLN------NDSDEVDTDMVDDLLAFYSEEA-KVNESEDLQNAIELTRDNIKAIIMDV 309
225427752 237 VKARGSLDEFIDKIIDGHIEKRKKQn-nSGDESESEAELDIVDELMEFYSKDV----AAEDLNSSIKFTRDNIKAIIMDV 311
225427746 237 VKARGSLDEFIDKIIDDHIEKRKKQn-nSGDESESEAELDMVDELMEFYSEDV----AAEDLNSSIKFTRDNIKAIIMDV 311
297798290 240 VKARNDLDGFIDDIIDEHMKKKENQ---NAVDDGDVVDTDMVDDLLAFYSEEAkLVSEAADLQNSIKLTRDNIKAIIMDV 316
224105309 316 MFGGTETVASAIEWAIAELMKSPEDLKKVHQELMDVVGLNRTVHESDLEKLIYLKCAMKETLRLHPPIPLLLHETAKDTV 395
15234332  317 MFGGTETVASAIEWALTELLRSPEDLKRVQQELAEVVGLDRRVEESDIEKLTYLKCTLKETLRMHPPIPLLLHETAEDTS 396
224134158 298 MFGGTETVASAIEWAMAELLKSPEDIKRVQQELADVVGLERRVEESDFDKLTFFKCTLKETLRLHPPIPLLLHETSEDAE 377
224134154 310 MFGGTETVASAIEWAMAELLKSPEDIKRVQQELADVVGLERRVEESDFDKLTFFKCTLKETLRLHPPIPLLLHETSEDAE 389
224094911 311 MFGGTETVASAIEWVMAELMKSPEDQKRVQQELADVVGLERRVEESDIEKLTFLKCALKETLRMHPPIPLLLHETSEDAE 390
225431217 310 MFGGTETVASAIEWAMAEMMKSPEDLKKVQQELADVVGLNRRVEESDLEKLTYLKCVLKETLRLHPPIPLLLHETAEDAE 389
225427752 312 MFGGTETVASAIEWAMAELMKSPDDLKKLQQELIDVVGLNRRLHESDLEKLTYLKCCIKETLRLHPPIPVLLHETAEDSV 391
225427746 312 MFGGTETVASAIEWAMAELMKSPDDLKKLQQELTDVVGLNRRLHESDLEKLTYLKCCIKETLRLHPPIPVLLHETSEASV 391
297798290 317 MFGGTETVASAIEWALTELLRSPEDLKRVQQELAEVVGLDRRVEEADIEKLTYLKCTLKETLRMHPPIPLLLHETAEDTS 396
224105309 396 LNGYRIPARSRVMINAWAIGRDPNAWEDPDKFNPSRFLDGKAPDFRGMDFEFLPFGSGRRSCPGMQLGLYALELAVAHLL 475
15234332  397 IDGFFIPKKSRVMINAFAIGRDPTSWTDPDTFRPSRFLEPGVPDFKGSNFEFIPFGSGRRSCPGMQLGLYALDLAVAHIL 476
224134158 378 VAGYYVPKKTRVMINAYAIGRDKNSWEDPDSFKPSRFLEPGVPDFKGNHFEFIPFGSGRRSCPGMQLGLYALDLAVAHLL 457
224134154 390 VAGYYVPKKTRVMINAYAIGRDKNSWEDPDSFKPSRFLEPGVPDFKGNHFEFIPFGSGRRSCPGMQLGLYALDLAVAHLL 469
224094911 391 VAGYFIPKQTRVMINAYAIGRDKNSWEDPDAFKPSRFLKPGVPDFKGNHFEFIPFGSGRRSCPGMQLGLYTLDLAVAHLL 470
225431217 390 VAGYHIPARSRVMINAWAIGRDKNSWDEPETFKPSRFLKAGVPDFKGSNFEFIPFGSGRRSCPGMQLGLYALELAVVHLL 469
225427752 392 VAGYSVPARSDVMINAWAINRDKTAWEDPETFKPERFLK-DAPDFKGSHFEFIPFGSGRRSCPGMQLGLYGLDLAVGHLV 470
225427746 392 VAGYSVPARSDVMINAWAINRDKTAWEDPETFKPERFLKKDAPDFKGSHFEFIPFGSGRRSCPGMQLGLYGLDLAVAHLV 471
297798290 397 IDGFFIPKKSRVMINAFAIGRDPTSWADPDTFRPSRFLEPGVPDFKGSNFEFIPFGSGRRSCPGMQLGLYALDLAVAHIL 476
224105309 476 HCFNWELPHGMKPAELDMNDVFGLTAPRAVRLVAVPTYRLNCPL 519
15234332  477 HCFTWKLPDGMKPSELDMNDVFGLTAPKATRLFAVPTTRLICAL 520
224134158 458 HCFTWELPDGMKPSELDMTDMFGLTAPRATRLVAVPRKRVVCPL 501
224134154 470 HCFTWELPDGMKPSELDMTDMFGLTAPRATRLVAVPRKRVVCPL 513
224094911 471 HCFTWELPDGMKPSELDMTDMFGLTAPRATRLVAVPSKRVLCPL 514
225431217 470 HCFTWELPDGMKPSELDMGDVFGLTAPRATRLVAVPSPRLECPL 513
225427752 471 HCFSWELPDGMKASDLDMSDVFGLTAPRAIQLIAVPTYRLQCLL 514
225427746 472 HCFSWELPDGMKASDLDMSDLFGLTAPRAIQLVAVPTYRLQCPL 515
297798290 477 HCFTWKLPDGMKPSELDMNDVFGLTAPKATRLFAVPTTRLICAL 520
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap