Conserved Protein Domain Family
PLN02182

?
PLN02182: PLN02182 
cytidine deaminase
Statistics
?
PSSM-Id: 177837
View PSSM: PLN02182
Aligned: 2 rows
Threshold Bit Score: 655.203
Threshold Setting Gi: 15233628
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
297803078   1 MAQRPNLLSHLQDLVTKIKNMTMAQDRYKFVFTANEAAAEGVTEPIRLPNLIRKAMSLARAPISKYKVGAVGRTSSGRVY 80 
15233628    1 MAQRPNLLSHLQDLVTKFKNMTMAQDRFKFVFTANEAALEGVTDPIRLPNLIRKAMCLARAPISKYKVGAVGRASSGRVY 80 
297803078  81 LGVNVDFPGLPLHHSIHAEQFLVTNLALNSEKDLCELAVAISVDGKEFGTPCGHCRQFLMEMSNALDIKIMSKPKHEAGS 160
15233628   81 LGVNVDFPGLPLHHSIHAEQFLVTNLALNYEKDLCKLAVAISTDGLEFGTPCGNCLQFLMEMSNALDMKILSKPKHEAGS 160
297803078 161 FSSLRHLLPNVLPKGSPFLLEKRDNCLTLSGPAGEICSSDCSHLMCKALAAANNSFSPYTESPSGVALLDNDGKWYYGWY 240
15233628  161 FSSLRLLLPNVLPKGSPFLLEKRYNCLTLSGSAGEICSLDCSHLKRRALAAANNSFSPYTESPSGVALLDNDGNWYRGWY 240
297803078 241 IESVASNPSFGPVQAALVDFVTRSRGKRFNKIVRAVLVEKNNAIVSQERTAKMILDTIaAPNCDFKVFHCSVDGAKRLKY 320
15233628  241 IESVASNPSLGPVQAALVDFVARSRGKMFNKIVQAVLVEKNNASVSQERTAKIILDTI-APNCDFKVFHCSVDCAKRLKY 319
297803078 321 LRDTLVIDTsVGDYTGLHY 339
15233628  320 LRETLVIDT-LGDYTGLHY 337
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap